Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135UXY2

Protein Details
Accession A0A135UXY2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
65-100MRSKEEPPKKPTRSKPKPKKKKKGKKVRHTYKIVYPBasic
108-142IHNPLAPHNHKPHKKKKKAKKPTAPPKPWPTRYPSBasic
NLS Segment(s)
PositionSequence
68-93KEEPPKKPTRSKPKPKKKKKGKKVRH
115-135HNHKPHKKKKKAKKPTAPPKP
Subcellular Location(s) extr 8, golg 6, mito 5, plas 3, vacu 3
Family & Domain DBs
Amino Acid Sequences MRTSLFLAGFLATLSVIATSVTPTPTDLNTIEPEHLTQDLEVPDLGSEGSLMAEPDLTTDEHPWMRSKEEPPKKPTRSKPKPKKKKKGKKVRHTYKIVYPAPGWHYPIHNPLAPHNHKPHKKKKKAKKPTAPPKPWPTRYPSFEEWMNNPDAPPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.06
7 0.07
8 0.08
9 0.08
10 0.1
11 0.11
12 0.12
13 0.15
14 0.14
15 0.16
16 0.18
17 0.2
18 0.19
19 0.18
20 0.18
21 0.16
22 0.16
23 0.14
24 0.11
25 0.12
26 0.12
27 0.12
28 0.11
29 0.09
30 0.09
31 0.08
32 0.08
33 0.04
34 0.04
35 0.03
36 0.04
37 0.04
38 0.04
39 0.03
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.07
47 0.1
48 0.11
49 0.12
50 0.14
51 0.14
52 0.16
53 0.2
54 0.24
55 0.32
56 0.41
57 0.47
58 0.52
59 0.61
60 0.65
61 0.7
62 0.74
63 0.75
64 0.76
65 0.81
66 0.85
67 0.86
68 0.91
69 0.94
70 0.95
71 0.95
72 0.96
73 0.95
74 0.95
75 0.95
76 0.95
77 0.95
78 0.95
79 0.93
80 0.88
81 0.82
82 0.77
83 0.76
84 0.66
85 0.57
86 0.46
87 0.4
88 0.38
89 0.36
90 0.31
91 0.23
92 0.24
93 0.24
94 0.29
95 0.28
96 0.25
97 0.24
98 0.26
99 0.35
100 0.38
101 0.42
102 0.47
103 0.53
104 0.6
105 0.7
106 0.76
107 0.77
108 0.84
109 0.88
110 0.9
111 0.91
112 0.94
113 0.95
114 0.95
115 0.95
116 0.96
117 0.96
118 0.94
119 0.92
120 0.91
121 0.91
122 0.87
123 0.8
124 0.77
125 0.75
126 0.72
127 0.7
128 0.63
129 0.58
130 0.55
131 0.55
132 0.5
133 0.45
134 0.44
135 0.36