FuNGI

A0A135RQL3

Protein Details

Accession

A0A135RQL3

Localization Confidence

Low

Confidence Score

9.8

NoLS Segment(s)

Position	Sequence	Protein Nature
382-415	SPSGTPTKTKTKPEKPESKNKHKRNKFKLTGVVK	Hydrophilic

NLS Segment(s)

Position	Sequence
389-420	KTKTKPEKPESKNKHKRNKFKLTGVVKPRQPR

Subcellular Location(s)

mito 14.5, cyto_mito 9, nucl 6, cyto 2.5, extr 2

Family & Domain DBs

InterPro	View protein in InterPro IPR013178 Histone_AcTrfase_Rtt109/CBP IPR016849 Rtt109
Gene Ontology	GO:0005634 C:nucleus GO:0010484 F:histone H3 acetyltransferase activity GO:0016573 P:histone acetylation GO:0043618 P:regulation of transcription from RNA polymerase II promoter in response to stress
Pfam	View protein in Pfam PF08214 HAT_KAT11
PROSITE	View protein in PROSITE PS51728 RTT109_HAT

Amino Acid Sequences

MATPSRTKTTAQSSALLLEKLSAVLPKGYRFGIYHLSTPPTKTDALYSAPPEEREDKTFCEKHFLAISIDIRSSTTDAAQEEAKETASKELLVLALEVFIYTTAYSSTFFVAKADSTGYLKLHNLPKGTSSPIKEISSAFVSYLIEQRRRKGIQSIVSLFARAQDQYLFPGSVEYSGKHVLDDRGLVKWWCKVLDPLLENPPVGKGAPWGSVKGYLVIPGLDNYETKAFLPKTPKSAANWVLGHALEKISHYTKEYDWVPARCLIPRFPDDPKSRFRDELDEEAGKSKQIKTTGHWKSVKTLDTFWEMMAYRQECSSGRLTGFIWVVFDEEAERGQNDSASVALPTPNPSFDASNPPVTPSKQKAVRPVTPMSTPRKLFPVSPSGTPTKTKTKPEKPESKNKHKRNKFKLTGVVKPRQPRIKTQQRNYLLDKPISTAYYYWPAEGRGRKIVDENDYKRVNELLLRLDFAKPEIAASGTRRWISEVGMGDNWGMQVVGRKETQTPASNDSSAYAVNVISGLIKRKRPDDSATPSSDEPASKVNVLSTGLIRKKSKDESATADTAQASTANGEEAPQVNVLGAGLVRKKRDA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.44
3	0.37
4	0.28
5	0.2
6	0.17
7	0.15
8	0.15
9	0.12
10	0.11
11	0.15
12	0.18
13	0.19
14	0.22
15	0.22
16	0.24
17	0.24
18	0.27
19	0.3
20	0.3
21	0.32
22	0.33
23	0.37
24	0.36
25	0.37
26	0.36
27	0.3
28	0.29
29	0.26
30	0.26
31	0.25
32	0.27
33	0.3
34	0.29
35	0.32
36	0.33
37	0.34
38	0.35
39	0.36
40	0.35
41	0.35
42	0.36
43	0.35
44	0.42
45	0.46
46	0.42
47	0.46
48	0.43
49	0.42
50	0.43
51	0.4
52	0.32
53	0.33
54	0.34
55	0.28
56	0.28
57	0.24
58	0.2
59	0.2
60	0.19
61	0.14
62	0.13
63	0.14
64	0.14
65	0.15
66	0.17
67	0.16
68	0.16
69	0.16
70	0.15
71	0.14
72	0.14
73	0.16
74	0.15
75	0.14
76	0.12
77	0.13
78	0.13
79	0.12
80	0.11
81	0.08
82	0.07
83	0.07
84	0.06
85	0.05
86	0.05
87	0.05
88	0.04
89	0.05
90	0.05
91	0.06
92	0.07
93	0.08
94	0.1
95	0.1
96	0.1
97	0.1
98	0.11
99	0.1
100	0.1
101	0.11
102	0.11
103	0.12
104	0.14
105	0.14
106	0.15
107	0.16
108	0.22
109	0.27
110	0.29
111	0.29
112	0.27
113	0.3
114	0.31
115	0.35
116	0.34
117	0.31
118	0.33
119	0.37
120	0.37
121	0.35
122	0.33
123	0.3
124	0.28
125	0.25
126	0.19
127	0.15
128	0.15
129	0.15
130	0.2
131	0.22
132	0.27
133	0.29
134	0.33
135	0.4
136	0.42
137	0.43
138	0.44
139	0.46
140	0.45
141	0.5
142	0.5
143	0.46
144	0.44
145	0.42
146	0.35
147	0.29
148	0.23
149	0.16
150	0.13
151	0.1
152	0.11
153	0.12
154	0.15
155	0.13
156	0.11
157	0.12
158	0.11
159	0.13
160	0.13
161	0.11
162	0.13
163	0.15
164	0.15
165	0.14
166	0.16
167	0.15
168	0.15
169	0.18
170	0.16
171	0.15
172	0.16
173	0.17
174	0.16
175	0.18
176	0.19
177	0.17
178	0.16
179	0.17
180	0.19
181	0.25
182	0.26
183	0.26
184	0.29
185	0.3
186	0.28
187	0.26
188	0.23
189	0.17
190	0.15
191	0.11
192	0.09
193	0.1
194	0.15
195	0.16
196	0.16
197	0.16
198	0.18
199	0.18
200	0.18
201	0.16
202	0.12
203	0.11
204	0.11
205	0.1
206	0.08
207	0.1
208	0.08
209	0.08
210	0.08
211	0.09
212	0.09
213	0.09
214	0.14
215	0.14
216	0.17
217	0.25
218	0.26
219	0.3
220	0.33
221	0.35
222	0.33
223	0.39
224	0.39
225	0.38
226	0.36
227	0.31
228	0.29
229	0.27
230	0.25
231	0.18
232	0.14
233	0.08
234	0.09
235	0.1
236	0.11
237	0.11
238	0.12
239	0.14
240	0.14
241	0.18
242	0.18
243	0.22
244	0.25
245	0.25
246	0.25
247	0.27
248	0.27
249	0.25
250	0.26
251	0.22
252	0.22
253	0.24
254	0.26
255	0.25
256	0.33
257	0.36
258	0.38
259	0.43
260	0.44
261	0.43
262	0.42
263	0.4
264	0.38
265	0.36
266	0.36
267	0.33
268	0.28
269	0.26
270	0.26
271	0.25
272	0.19
273	0.17
274	0.14
275	0.13
276	0.17
277	0.18
278	0.19
279	0.29
280	0.34
281	0.41
282	0.43
283	0.4
284	0.41
285	0.44
286	0.45
287	0.36
288	0.32
289	0.25
290	0.25
291	0.25
292	0.2
293	0.18
294	0.15
295	0.14
296	0.17
297	0.16
298	0.12
299	0.12
300	0.14
301	0.11
302	0.14
303	0.16
304	0.13
305	0.13
306	0.14
307	0.14
308	0.15
309	0.15
310	0.12
311	0.1
312	0.09
313	0.09
314	0.08
315	0.07
316	0.05
317	0.05
318	0.05
319	0.05
320	0.06
321	0.06
322	0.06
323	0.06
324	0.05
325	0.05
326	0.05
327	0.05
328	0.05
329	0.05
330	0.06
331	0.06
332	0.09
333	0.1
334	0.1
335	0.11
336	0.12
337	0.13
338	0.14
339	0.22
340	0.21
341	0.25
342	0.24
343	0.25
344	0.26
345	0.27
346	0.31
347	0.27
348	0.32
349	0.35
350	0.38
351	0.45
352	0.5
353	0.54
354	0.53
355	0.52
356	0.47
357	0.45
358	0.48
359	0.45
360	0.45
361	0.41
362	0.37
363	0.38
364	0.37
365	0.34
366	0.32
367	0.34
368	0.29
369	0.3
370	0.33
371	0.32
372	0.33
373	0.34
374	0.34
375	0.35
376	0.39
377	0.46
378	0.52
379	0.59
380	0.68
381	0.75
382	0.81
383	0.79
384	0.84
385	0.85
386	0.87
387	0.87
388	0.87
389	0.88
390	0.87
391	0.91
392	0.9
393	0.91
394	0.87
395	0.83
396	0.83
397	0.78
398	0.77
399	0.75
400	0.72
401	0.66
402	0.65
403	0.66
404	0.65
405	0.62
406	0.62
407	0.64
408	0.68
409	0.73
410	0.74
411	0.77
412	0.75
413	0.78
414	0.75
415	0.73
416	0.67
417	0.59
418	0.51
419	0.43
420	0.38
421	0.33
422	0.27
423	0.19
424	0.17
425	0.23
426	0.22
427	0.21
428	0.2
429	0.21
430	0.27
431	0.31
432	0.32
433	0.32
434	0.33
435	0.33
436	0.36
437	0.38
438	0.39
439	0.44
440	0.44
441	0.45
442	0.46
443	0.45
444	0.42
445	0.38
446	0.32
447	0.25
448	0.23
449	0.22
450	0.2
451	0.22
452	0.22
453	0.22
454	0.21
455	0.19
456	0.19
457	0.12
458	0.12
459	0.11
460	0.11
461	0.12
462	0.16
463	0.2
464	0.22
465	0.23
466	0.23
467	0.25
468	0.25
469	0.24
470	0.26
471	0.23
472	0.22
473	0.21
474	0.21
475	0.19
476	0.18
477	0.16
478	0.11
479	0.08
480	0.05
481	0.11
482	0.13
483	0.16
484	0.17
485	0.19
486	0.21
487	0.25
488	0.31
489	0.31
490	0.33
491	0.36
492	0.39
493	0.38
494	0.36
495	0.33
496	0.28
497	0.21
498	0.18
499	0.13
500	0.09
501	0.08
502	0.08
503	0.07
504	0.07
505	0.09
506	0.17
507	0.22
508	0.28
509	0.31
510	0.36
511	0.42
512	0.45
513	0.5
514	0.52
515	0.56
516	0.58
517	0.59
518	0.58
519	0.52
520	0.5
521	0.45
522	0.36
523	0.28
524	0.24
525	0.23
526	0.2
527	0.2
528	0.19
529	0.18
530	0.19
531	0.19
532	0.19
533	0.26
534	0.29
535	0.36
536	0.37
537	0.4
538	0.46
539	0.51
540	0.56
541	0.53
542	0.53
543	0.54
544	0.58
545	0.58
546	0.51
547	0.46
548	0.38
549	0.32
550	0.27
551	0.2
552	0.13
553	0.1
554	0.1
555	0.09
556	0.08
557	0.09
558	0.11
559	0.12
560	0.13
561	0.13
562	0.13
563	0.12
564	0.12
565	0.11
566	0.09
567	0.08
568	0.11
569	0.17
570	0.21

A0A135RQL3

3D AlphaFold-predicted Structure Viewer