Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135V603

Protein Details
Accession A0A135V603    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-76FPIKPLPTKPERRRIRQVSVHydrophilic
NLS Segment(s)
PositionSequence
215-221KPKKKLG
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MTSSFSAKSLGSTNFHSLRSISNLEPFPPFDPSFDFTIKSKNKLSGLAHLYQSQAFFPIKPLPTKPERRRIRQVSVSQVSTISSSSVGRLCDLDENVFFRFPAFDQASVKQLDELLEHESRFAQYYNEDEEDDEWGVECDDIDESVVSSKRHPNIVDYEKHAEDSVIQQIYEDLPEVESSDFKTAKKSARNLRFGNYTTGKYVKIKSEHEDGASKPKKKLGKWATGFLRKAVGLFFPKNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.34
4 0.29
5 0.29
6 0.32
7 0.31
8 0.25
9 0.29
10 0.29
11 0.3
12 0.31
13 0.3
14 0.27
15 0.29
16 0.28
17 0.23
18 0.25
19 0.26
20 0.29
21 0.28
22 0.28
23 0.22
24 0.32
25 0.34
26 0.35
27 0.36
28 0.37
29 0.38
30 0.42
31 0.43
32 0.42
33 0.43
34 0.42
35 0.4
36 0.36
37 0.35
38 0.3
39 0.28
40 0.2
41 0.18
42 0.14
43 0.13
44 0.15
45 0.2
46 0.21
47 0.24
48 0.26
49 0.3
50 0.39
51 0.5
52 0.55
53 0.59
54 0.65
55 0.71
56 0.79
57 0.8
58 0.8
59 0.78
60 0.75
61 0.74
62 0.7
63 0.62
64 0.51
65 0.44
66 0.35
67 0.27
68 0.21
69 0.12
70 0.08
71 0.07
72 0.08
73 0.1
74 0.1
75 0.1
76 0.1
77 0.1
78 0.11
79 0.12
80 0.12
81 0.11
82 0.12
83 0.13
84 0.12
85 0.11
86 0.09
87 0.09
88 0.08
89 0.14
90 0.13
91 0.14
92 0.16
93 0.17
94 0.2
95 0.2
96 0.2
97 0.13
98 0.12
99 0.11
100 0.1
101 0.1
102 0.1
103 0.11
104 0.11
105 0.11
106 0.11
107 0.1
108 0.11
109 0.1
110 0.07
111 0.06
112 0.08
113 0.11
114 0.12
115 0.12
116 0.11
117 0.11
118 0.12
119 0.12
120 0.1
121 0.07
122 0.06
123 0.06
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.06
133 0.08
134 0.08
135 0.11
136 0.16
137 0.18
138 0.22
139 0.22
140 0.23
141 0.3
142 0.35
143 0.36
144 0.36
145 0.38
146 0.35
147 0.35
148 0.32
149 0.24
150 0.19
151 0.18
152 0.18
153 0.14
154 0.13
155 0.13
156 0.13
157 0.13
158 0.13
159 0.11
160 0.06
161 0.06
162 0.06
163 0.07
164 0.07
165 0.08
166 0.09
167 0.13
168 0.14
169 0.14
170 0.19
171 0.22
172 0.29
173 0.36
174 0.43
175 0.49
176 0.57
177 0.66
178 0.64
179 0.64
180 0.64
181 0.59
182 0.59
183 0.52
184 0.44
185 0.4
186 0.39
187 0.37
188 0.34
189 0.36
190 0.35
191 0.38
192 0.4
193 0.4
194 0.45
195 0.45
196 0.44
197 0.43
198 0.38
199 0.43
200 0.47
201 0.47
202 0.43
203 0.47
204 0.51
205 0.5
206 0.59
207 0.58
208 0.61
209 0.61
210 0.68
211 0.72
212 0.73
213 0.72
214 0.63
215 0.57
216 0.46
217 0.42
218 0.33
219 0.29
220 0.27