Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135UBP3

Protein Details
Accession A0A135UBP3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKSSSKPQGPKKVRLLLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 7.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Amino Acid Sequences MGKRKSSSKPQGPKKVRLLLRSSTVPTPREVLPSKFTCLFCNHEDSVAVKLDKKAGVDLSAAVDVYGEWVDAADAVAKEAGPVGGSNHKTTSARRAPPSRPVDDDDDDRRYGGEGIDMDDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.79
4 0.76
5 0.7
6 0.64
7 0.62
8 0.56
9 0.5
10 0.47
11 0.46
12 0.41
13 0.36
14 0.35
15 0.3
16 0.33
17 0.33
18 0.3
19 0.32
20 0.33
21 0.36
22 0.38
23 0.38
24 0.34
25 0.34
26 0.35
27 0.3
28 0.33
29 0.29
30 0.24
31 0.24
32 0.22
33 0.21
34 0.19
35 0.17
36 0.13
37 0.13
38 0.15
39 0.16
40 0.15
41 0.14
42 0.11
43 0.12
44 0.11
45 0.1
46 0.09
47 0.08
48 0.07
49 0.06
50 0.05
51 0.04
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.03
69 0.04
70 0.06
71 0.12
72 0.14
73 0.16
74 0.17
75 0.19
76 0.21
77 0.22
78 0.31
79 0.33
80 0.38
81 0.44
82 0.51
83 0.52
84 0.61
85 0.66
86 0.61
87 0.56
88 0.54
89 0.52
90 0.5
91 0.51
92 0.47
93 0.44
94 0.4
95 0.36
96 0.32
97 0.27
98 0.23
99 0.18
100 0.16
101 0.12
102 0.14
103 0.16