Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135V3L1

Protein Details
Accession A0A135V3L1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-107RNRGAIPYRSGRRRRRKSTTLDCESAHydrophilic
NLS Segment(s)
PositionSequence
84-98RGAIPYRSGRRRRRK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MCLNVPVPRSNFGQTKRLAQGDLPARLGTYLCLGIRTPHSVGAAETRASGSPEASYFSPLRQISSEFSSSLVQTRSTDYRGRNRGAIPYRSGRRRRRKSTTLDCESAAGEAPGLQGGLGQPEQTRIMAKPMQVCSAGSWSVSGVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.49
4 0.47
5 0.42
6 0.36
7 0.39
8 0.39
9 0.39
10 0.34
11 0.28
12 0.26
13 0.25
14 0.25
15 0.17
16 0.12
17 0.11
18 0.1
19 0.11
20 0.11
21 0.13
22 0.16
23 0.19
24 0.17
25 0.17
26 0.18
27 0.17
28 0.17
29 0.19
30 0.18
31 0.14
32 0.14
33 0.13
34 0.12
35 0.13
36 0.13
37 0.09
38 0.08
39 0.08
40 0.1
41 0.09
42 0.12
43 0.11
44 0.11
45 0.18
46 0.17
47 0.18
48 0.16
49 0.18
50 0.17
51 0.2
52 0.2
53 0.14
54 0.15
55 0.15
56 0.14
57 0.15
58 0.13
59 0.1
60 0.1
61 0.13
62 0.13
63 0.15
64 0.2
65 0.22
66 0.3
67 0.35
68 0.36
69 0.36
70 0.35
71 0.4
72 0.42
73 0.41
74 0.36
75 0.39
76 0.44
77 0.51
78 0.59
79 0.62
80 0.67
81 0.75
82 0.8
83 0.82
84 0.83
85 0.85
86 0.86
87 0.86
88 0.82
89 0.73
90 0.64
91 0.55
92 0.47
93 0.37
94 0.26
95 0.16
96 0.08
97 0.06
98 0.06
99 0.05
100 0.05
101 0.04
102 0.04
103 0.04
104 0.07
105 0.07
106 0.08
107 0.08
108 0.11
109 0.12
110 0.13
111 0.15
112 0.13
113 0.19
114 0.21
115 0.24
116 0.28
117 0.3
118 0.32
119 0.31
120 0.31
121 0.27
122 0.29
123 0.26
124 0.19
125 0.17