Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135V5Y9

Protein Details
Accession A0A135V5Y9   
Localization Confidence High
Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-46VEKKVLRPAPSRVKKRKFVTKSSRSADHydrophilic
56-86TKTEPKTKTKGDPKCKPKPKGKDKAKATDKABasic
95-118TSMKSSKRVIKRTKKSKGLPKGLVHydrophilic
NLS Segment(s)
PositionSequence
18-115VPVEKKVLRPAPSRVKKRKFVTKSSRSADRVTNKASDETKTEPKTKTKGDPKCKPKPKGKDKAKATDKASGDPAPIPTSMKSSKRVIKRTKKSKGLPK
152-172KKRGDGEGAKATAEPKKMKRK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MPILKPAPRSANIRIERVPVEKKVLRPAPSRVKKRKFVTKSSRSADRVTNKASDETKTEPKTKTKGDPKCKPKPKGKDKAKATDKASGDPAPIPTSMKSSKRVIKRTKKSKGLPKGLVAIGSFGSAAATHRSQLGAKTNIRLLPSALPLPIKKRGDGEGAKATAEPKKMKRKVNTATTGLTTPSPTPSCGSSRSRKQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.48
4 0.49
5 0.47
6 0.4
7 0.44
8 0.43
9 0.44
10 0.5
11 0.53
12 0.53
13 0.52
14 0.59
15 0.61
16 0.67
17 0.75
18 0.75
19 0.78
20 0.81
21 0.85
22 0.87
23 0.83
24 0.84
25 0.84
26 0.83
27 0.83
28 0.79
29 0.8
30 0.72
31 0.67
32 0.65
33 0.61
34 0.56
35 0.5
36 0.47
37 0.4
38 0.41
39 0.39
40 0.33
41 0.3
42 0.3
43 0.36
44 0.36
45 0.4
46 0.4
47 0.44
48 0.48
49 0.49
50 0.53
51 0.55
52 0.6
53 0.66
54 0.72
55 0.76
56 0.81
57 0.86
58 0.85
59 0.84
60 0.85
61 0.86
62 0.87
63 0.87
64 0.86
65 0.84
66 0.86
67 0.83
68 0.79
69 0.71
70 0.67
71 0.58
72 0.5
73 0.45
74 0.35
75 0.29
76 0.23
77 0.21
78 0.15
79 0.14
80 0.13
81 0.1
82 0.14
83 0.18
84 0.19
85 0.22
86 0.26
87 0.32
88 0.38
89 0.47
90 0.54
91 0.6
92 0.68
93 0.75
94 0.79
95 0.82
96 0.82
97 0.83
98 0.83
99 0.81
100 0.74
101 0.65
102 0.6
103 0.51
104 0.44
105 0.34
106 0.24
107 0.16
108 0.12
109 0.1
110 0.06
111 0.05
112 0.04
113 0.05
114 0.07
115 0.07
116 0.08
117 0.08
118 0.09
119 0.1
120 0.13
121 0.19
122 0.22
123 0.23
124 0.25
125 0.28
126 0.29
127 0.3
128 0.28
129 0.22
130 0.19
131 0.2
132 0.19
133 0.17
134 0.18
135 0.19
136 0.23
137 0.3
138 0.29
139 0.28
140 0.29
141 0.31
142 0.36
143 0.37
144 0.38
145 0.36
146 0.36
147 0.34
148 0.32
149 0.32
150 0.28
151 0.31
152 0.32
153 0.34
154 0.45
155 0.52
156 0.61
157 0.67
158 0.73
159 0.77
160 0.8
161 0.78
162 0.71
163 0.67
164 0.61
165 0.53
166 0.45
167 0.36
168 0.28
169 0.22
170 0.25
171 0.23
172 0.22
173 0.22
174 0.25
175 0.27
176 0.31
177 0.38
178 0.42