Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135S2P2

Protein Details
Accession A0A135S2P2   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-52KKPLPAKPKPSTKTEQKTKKPISQSQPPPKAAHydrophilic
78-100EDEPKAKPAKKAKKPAAGKKEAPBasic
NLS Segment(s)
PositionSequence
21-59KKPLPAKPKPSTKTEQKTKKPISQSQPPPKAAVGRKRKA
81-105PKAKPAKKAKKPAAGKKEAPPKKTK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.833, cyto_mito 4.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002740  EVE_domain  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01878  EVE  
CDD cd21133  EVE  
Amino Acid Sequences MPALTRSLRSSTRLNTVPDEKKPLPAKPKPSTKTEQKTKKPISQSQPPPKAAVGRKRKAAEETAEKEEETKAEAIEDEDEPKAKPAKKAKKPAAGKKEAPPKKTKDELKALRDAPVPDVNSEVEPRDPPGPRYWLMKSEPDVRIEDGYEIKFSIDDLAAKKTPEGWEGIAGIRNYVARNNLRGMRKGDKAFFYHSNCKEPGVVGIMSIAKEHSPDWNACINDNPYYDDNAPHDGSKWSLVHVKIEHKFPRIVPLSLLKESRGNGPLQNMELLKQSRLSVNKVTREEWDEVIRMAKELDEDKEWDQTVEESKKFPNYSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.54
4 0.57
5 0.56
6 0.6
7 0.53
8 0.57
9 0.59
10 0.6
11 0.61
12 0.63
13 0.67
14 0.68
15 0.78
16 0.73
17 0.76
18 0.77
19 0.77
20 0.8
21 0.8
22 0.81
23 0.8
24 0.87
25 0.87
26 0.86
27 0.85
28 0.83
29 0.81
30 0.81
31 0.82
32 0.82
33 0.83
34 0.76
35 0.7
36 0.63
37 0.62
38 0.6
39 0.59
40 0.59
41 0.56
42 0.63
43 0.63
44 0.64
45 0.6
46 0.57
47 0.54
48 0.53
49 0.52
50 0.5
51 0.48
52 0.44
53 0.4
54 0.36
55 0.28
56 0.22
57 0.17
58 0.11
59 0.1
60 0.11
61 0.11
62 0.12
63 0.12
64 0.12
65 0.12
66 0.13
67 0.12
68 0.16
69 0.21
70 0.22
71 0.29
72 0.38
73 0.48
74 0.57
75 0.67
76 0.73
77 0.77
78 0.83
79 0.86
80 0.86
81 0.83
82 0.78
83 0.75
84 0.77
85 0.73
86 0.69
87 0.66
88 0.62
89 0.62
90 0.66
91 0.64
92 0.61
93 0.66
94 0.68
95 0.66
96 0.67
97 0.59
98 0.54
99 0.51
100 0.44
101 0.37
102 0.33
103 0.28
104 0.21
105 0.22
106 0.19
107 0.17
108 0.17
109 0.14
110 0.11
111 0.11
112 0.12
113 0.16
114 0.16
115 0.17
116 0.21
117 0.24
118 0.24
119 0.28
120 0.28
121 0.28
122 0.3
123 0.32
124 0.31
125 0.35
126 0.35
127 0.33
128 0.32
129 0.28
130 0.26
131 0.22
132 0.2
133 0.14
134 0.13
135 0.11
136 0.09
137 0.08
138 0.08
139 0.07
140 0.07
141 0.05
142 0.07
143 0.08
144 0.11
145 0.12
146 0.12
147 0.12
148 0.13
149 0.14
150 0.13
151 0.13
152 0.1
153 0.1
154 0.11
155 0.12
156 0.13
157 0.12
158 0.11
159 0.1
160 0.1
161 0.1
162 0.1
163 0.14
164 0.13
165 0.15
166 0.18
167 0.24
168 0.25
169 0.29
170 0.33
171 0.33
172 0.38
173 0.39
174 0.38
175 0.35
176 0.35
177 0.36
178 0.37
179 0.38
180 0.42
181 0.41
182 0.43
183 0.4
184 0.39
185 0.34
186 0.29
187 0.24
188 0.18
189 0.15
190 0.1
191 0.11
192 0.11
193 0.1
194 0.1
195 0.09
196 0.06
197 0.07
198 0.07
199 0.1
200 0.12
201 0.12
202 0.15
203 0.2
204 0.21
205 0.21
206 0.24
207 0.23
208 0.23
209 0.24
210 0.24
211 0.2
212 0.23
213 0.24
214 0.22
215 0.21
216 0.23
217 0.23
218 0.19
219 0.2
220 0.17
221 0.17
222 0.19
223 0.17
224 0.16
225 0.2
226 0.2
227 0.24
228 0.27
229 0.34
230 0.33
231 0.41
232 0.44
233 0.42
234 0.44
235 0.4
236 0.46
237 0.42
238 0.39
239 0.34
240 0.37
241 0.39
242 0.4
243 0.4
244 0.32
245 0.32
246 0.32
247 0.34
248 0.29
249 0.25
250 0.24
251 0.27
252 0.28
253 0.26
254 0.28
255 0.23
256 0.22
257 0.26
258 0.26
259 0.23
260 0.22
261 0.22
262 0.25
263 0.28
264 0.31
265 0.34
266 0.4
267 0.48
268 0.49
269 0.49
270 0.48
271 0.5
272 0.48
273 0.42
274 0.38
275 0.31
276 0.29
277 0.31
278 0.27
279 0.22
280 0.19
281 0.16
282 0.16
283 0.17
284 0.2
285 0.19
286 0.22
287 0.23
288 0.28
289 0.28
290 0.25
291 0.23
292 0.22
293 0.28
294 0.32
295 0.32
296 0.3
297 0.33
298 0.41
299 0.41