Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135T0A4

Protein Details
Accession A0A135T0A4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-30DFIPAAFKPKPPKRAPKPQQTSYTSNHydrophilic
NLS Segment(s)
PositionSequence
13-20PKPPKRAP
Subcellular Location(s) mito 21, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045054  P4HA-like  
IPR044862  Pro_4_hyd_alph_FE2OG_OXY  
Pfam View protein in Pfam  
PF13640  2OG-FeII_Oxy_3  
Amino Acid Sequences MSISDFIPAAFKPKPPKRAPKPQQTSYTSNQVPIPSDFLSCPLPPSAPAVTLQKLDWXXXXXXXALPENGPLYAVILDNVLTPAECAQLLRMAEASATDRGPDPDKDEPWRPAMVNMGPRWEILEPEYRNSDRIIWDQQEVVDRLWGRSHCDGPYGEEAEDGTVSRTHYTVHLYLNDSIAEAGKDSGADLVGGATSFLSGDEKRKVDVDPKAGRVLIFQHSRLYHSGDDVVKGTKYTMRTDILYEMIKTKIGDEEKGNEDEVMTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.69
4 0.74
5 0.83
6 0.88
7 0.89
8 0.9
9 0.88
10 0.88
11 0.83
12 0.8
13 0.74
14 0.73
15 0.63
16 0.56
17 0.5
18 0.42
19 0.38
20 0.33
21 0.32
22 0.23
23 0.23
24 0.21
25 0.21
26 0.22
27 0.19
28 0.2
29 0.17
30 0.16
31 0.15
32 0.19
33 0.18
34 0.15
35 0.18
36 0.2
37 0.21
38 0.21
39 0.21
40 0.2
41 0.2
42 0.19
43 0.18
44 0.18
45 0.17
46 0.16
47 0.18
48 0.16
49 0.15
50 0.15
51 0.13
52 0.1
53 0.09
54 0.09
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.05
66 0.05
67 0.05
68 0.09
69 0.09
70 0.09
71 0.09
72 0.08
73 0.08
74 0.09
75 0.1
76 0.08
77 0.08
78 0.09
79 0.09
80 0.11
81 0.14
82 0.14
83 0.17
84 0.19
85 0.22
86 0.26
87 0.3
88 0.3
89 0.3
90 0.31
91 0.27
92 0.23
93 0.24
94 0.22
95 0.24
96 0.22
97 0.22
98 0.2
99 0.2
100 0.21
101 0.17
102 0.15
103 0.11
104 0.18
105 0.16
106 0.18
107 0.22
108 0.21
109 0.21
110 0.21
111 0.21
112 0.15
113 0.17
114 0.19
115 0.17
116 0.17
117 0.17
118 0.17
119 0.18
120 0.17
121 0.14
122 0.13
123 0.12
124 0.12
125 0.15
126 0.14
127 0.15
128 0.17
129 0.19
130 0.16
131 0.19
132 0.18
133 0.19
134 0.22
135 0.19
136 0.17
137 0.15
138 0.14
139 0.12
140 0.12
141 0.09
142 0.07
143 0.06
144 0.07
145 0.07
146 0.07
147 0.08
148 0.09
149 0.12
150 0.13
151 0.14
152 0.16
153 0.18
154 0.19
155 0.19
156 0.18
157 0.15
158 0.13
159 0.11
160 0.09
161 0.06
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.06
179 0.07
180 0.11
181 0.17
182 0.18
183 0.19
184 0.2
185 0.22
186 0.27
187 0.32
188 0.37
189 0.38
190 0.4
191 0.42
192 0.41
193 0.39
194 0.33
195 0.31
196 0.29
197 0.27
198 0.25
199 0.28
200 0.28
201 0.31
202 0.32
203 0.32
204 0.25
205 0.23
206 0.28
207 0.23
208 0.24
209 0.23
210 0.23
211 0.19
212 0.19
213 0.19
214 0.17
215 0.19
216 0.21
217 0.24
218 0.25
219 0.26
220 0.28
221 0.29
222 0.29
223 0.28
224 0.25
225 0.23
226 0.21
227 0.22
228 0.2
229 0.18
230 0.22
231 0.22
232 0.25
233 0.26
234 0.31
235 0.34
236 0.36
237 0.35
238 0.28