Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135S6V9

Protein Details
Accession A0A135S6V9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-94VRGNKALFKRIEKKKKFRPVRKSSKKPBasic
NLS Segment(s)
PositionSequence
72-94KALFKRIEKKKKFRPVRKSSKKP
Subcellular Location(s) nucl 14, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
IPR036987  SRA-YDG_sf  
IPR003105  SRA_YDG  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF02182  SAD_SRA  
PROSITE View protein in PROSITE  
PS51015  YDG  
Amino Acid Sequences MYLGGHGESNAGISYTKDEHGNIGPAASIIMAEKYGAMDVDQGETITYCGTNSMETIRDTPADGAQLVRGNKALFKRIEKKKKFRPVRKSSKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.14
5 0.14
6 0.16
7 0.18
8 0.2
9 0.16
10 0.15
11 0.13
12 0.12
13 0.11
14 0.08
15 0.06
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.05
26 0.05
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.03
36 0.04
37 0.04
38 0.04
39 0.05
40 0.06
41 0.08
42 0.08
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.11
49 0.1
50 0.09
51 0.08
52 0.1
53 0.14
54 0.13
55 0.13
56 0.14
57 0.14
58 0.17
59 0.2
60 0.24
61 0.25
62 0.33
63 0.42
64 0.52
65 0.63
66 0.7
67 0.78
68 0.82
69 0.89
70 0.91
71 0.92
72 0.92
73 0.92
74 0.94