Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135UAY7

Protein Details
Accession A0A135UAY7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-159DKSEEKKEPKEKKEPKEEKKSEDSEEKPKEKKDEKKDEKRGEDKEAcidic
183-218KSENKKEKSEDKKEEKSEDKKEDSKDEKKEDKKEDNAcidic
NLS Segment(s)
PositionSequence
108-215KPKEKEDDKSEEKKEPKEKKEPKEEKKSEDSEEKPKEKKDEKKDEKRGEDKEEKSDDKKENSEDKKEDKSEDKEDKSENKKEKSEDKKEEKSEDKKEDSKDEKKEDKK
Subcellular Location(s) nucl 11.5, mito_nucl 10.833, mito 9, cyto_mito 5.833, golg 4
Family & Domain DBs
Amino Acid Sequences MSFARAAPLRSALRSSARRTIRPQFRSQVSQRTYASQHGAKPQSELPLVIGSVVFFAAGLAVIQPWSAPTPAKGHGGAHAKHDEEEKHDEPEEKEEEESKSEDKDESKPKEKEDDKSEEKKEPKEKKEPKEEKKSEDSEEKPKEKKDEKKDEKRGEDKEEKSDDKKENSEDKKEDKSEDKEDKSENKKEKSEDKKEEKSEDKKEDSKDEKKEDKKEDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.47
4 0.51
5 0.54
6 0.59
7 0.66
8 0.68
9 0.68
10 0.7
11 0.69
12 0.69
13 0.72
14 0.71
15 0.7
16 0.63
17 0.63
18 0.57
19 0.53
20 0.49
21 0.44
22 0.44
23 0.38
24 0.38
25 0.4
26 0.44
27 0.39
28 0.4
29 0.38
30 0.36
31 0.33
32 0.3
33 0.22
34 0.19
35 0.18
36 0.15
37 0.13
38 0.08
39 0.07
40 0.07
41 0.05
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.05
54 0.06
55 0.06
56 0.08
57 0.12
58 0.14
59 0.17
60 0.17
61 0.16
62 0.22
63 0.28
64 0.27
65 0.28
66 0.28
67 0.26
68 0.26
69 0.28
70 0.23
71 0.21
72 0.27
73 0.24
74 0.24
75 0.24
76 0.26
77 0.24
78 0.28
79 0.25
80 0.18
81 0.18
82 0.17
83 0.17
84 0.17
85 0.17
86 0.13
87 0.12
88 0.12
89 0.13
90 0.13
91 0.18
92 0.25
93 0.3
94 0.38
95 0.39
96 0.4
97 0.47
98 0.48
99 0.48
100 0.45
101 0.47
102 0.46
103 0.51
104 0.53
105 0.51
106 0.51
107 0.53
108 0.57
109 0.58
110 0.58
111 0.62
112 0.68
113 0.7
114 0.78
115 0.81
116 0.81
117 0.83
118 0.81
119 0.76
120 0.74
121 0.69
122 0.62
123 0.59
124 0.54
125 0.52
126 0.56
127 0.55
128 0.52
129 0.52
130 0.56
131 0.57
132 0.63
133 0.64
134 0.67
135 0.72
136 0.79
137 0.86
138 0.87
139 0.87
140 0.85
141 0.8
142 0.77
143 0.75
144 0.67
145 0.64
146 0.61
147 0.57
148 0.53
149 0.56
150 0.52
151 0.48
152 0.49
153 0.48
154 0.51
155 0.53
156 0.58
157 0.55
158 0.56
159 0.59
160 0.57
161 0.56
162 0.53
163 0.53
164 0.54
165 0.58
166 0.56
167 0.52
168 0.55
169 0.6
170 0.6
171 0.64
172 0.63
173 0.61
174 0.63
175 0.65
176 0.69
177 0.71
178 0.74
179 0.75
180 0.76
181 0.78
182 0.79
183 0.81
184 0.8
185 0.79
186 0.78
187 0.76
188 0.74
189 0.71
190 0.7
191 0.71
192 0.71
193 0.71
194 0.7
195 0.71
196 0.74
197 0.76
198 0.81