Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135S5R2

Protein Details
Accession A0A135S5R2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-102ANTGNARNGRNRNNANKKRRIHydrophilic
NLS Segment(s)
PositionSequence
95-102NANKKRRI
Subcellular Location(s) extr 20, cyto 3, nucl 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MHFSTIIITLFSAGVLAQNGCGFPDGPDCQSLGKDANGLEQFADPDGCCLLPLRCGNGDGGERCERVSGASAGGATNNNNNANTGNARNGRNRNNANKKRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.07
11 0.13
12 0.14
13 0.15
14 0.16
15 0.16
16 0.16
17 0.16
18 0.17
19 0.12
20 0.11
21 0.11
22 0.1
23 0.15
24 0.15
25 0.15
26 0.14
27 0.12
28 0.12
29 0.11
30 0.12
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.06
37 0.06
38 0.1
39 0.1
40 0.12
41 0.12
42 0.13
43 0.13
44 0.14
45 0.16
46 0.13
47 0.17
48 0.18
49 0.17
50 0.17
51 0.17
52 0.15
53 0.13
54 0.15
55 0.11
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.08
63 0.1
64 0.14
65 0.15
66 0.15
67 0.16
68 0.16
69 0.18
70 0.2
71 0.2
72 0.24
73 0.27
74 0.31
75 0.39
76 0.46
77 0.51
78 0.58
79 0.65
80 0.69
81 0.75
82 0.81