Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A117E120

Protein Details
Accession A0A117E120    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-42AGPRKRARVEKPKKPAKEQRDBasic
NLS Segment(s)
PositionSequence
23-73GPRKRARVEKPKKPAKEQRDITKMSAAEKKKEIARLRAAIKEEELKRKREK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MEHPTQAIFHNAVFLAGSFSGAGPRKRARVEKPKKPAKEQRDITKMSAAEKKKEIARLRAAIKEEELKRKREKVAALEASIMADEADDKLMIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.09
5 0.07
6 0.07
7 0.12
8 0.16
9 0.17
10 0.21
11 0.25
12 0.29
13 0.34
14 0.42
15 0.46
16 0.54
17 0.63
18 0.67
19 0.74
20 0.79
21 0.79
22 0.82
23 0.82
24 0.79
25 0.79
26 0.75
27 0.73
28 0.71
29 0.68
30 0.59
31 0.53
32 0.45
33 0.38
34 0.39
35 0.31
36 0.27
37 0.26
38 0.28
39 0.26
40 0.33
41 0.34
42 0.34
43 0.38
44 0.4
45 0.42
46 0.43
47 0.42
48 0.35
49 0.33
50 0.35
51 0.34
52 0.39
53 0.39
54 0.42
55 0.46
56 0.51
57 0.54
58 0.52
59 0.53
60 0.49
61 0.56
62 0.54
63 0.48
64 0.44
65 0.39
66 0.33
67 0.28
68 0.21
69 0.1
70 0.06
71 0.06
72 0.05
73 0.06
74 0.06