Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A117E1D9

Protein Details
Accession A0A117E1D9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
86-108GAPLKRVPTPHPKKNKDQYDDDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.833, cyto 10.5, mito_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MDKIVSFSNWIKVAKAKSQPAAPMYVFKSHGNDNEPPKKRQKVSHHSPFAIDGVVEEPTTQDDEQSIRVIEGEVVEFMGIDDYEFGAPLKRVPTPHPKKNKDQYDDDDDDEEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.43
4 0.43
5 0.46
6 0.49
7 0.45
8 0.45
9 0.37
10 0.34
11 0.31
12 0.31
13 0.3
14 0.27
15 0.28
16 0.26
17 0.29
18 0.29
19 0.32
20 0.37
21 0.45
22 0.48
23 0.5
24 0.56
25 0.6
26 0.6
27 0.64
28 0.65
29 0.65
30 0.71
31 0.77
32 0.74
33 0.67
34 0.63
35 0.54
36 0.44
37 0.34
38 0.23
39 0.13
40 0.08
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.07
47 0.07
48 0.06
49 0.06
50 0.07
51 0.08
52 0.09
53 0.09
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.07
75 0.09
76 0.11
77 0.13
78 0.15
79 0.22
80 0.33
81 0.41
82 0.51
83 0.6
84 0.65
85 0.74
86 0.82
87 0.86
88 0.81
89 0.8
90 0.77
91 0.76
92 0.73
93 0.64
94 0.56