Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JAE4

Protein Details
Accession G3JAE4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-120PLRCTGLPRRRHPCTQRCIRGAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 7, nucl 5, cyto_mito 5
Family & Domain DBs
KEGG cmt:CCM_03384  -  
Amino Acid Sequences MKVSTSNIIALLALAATNVVAAPATGGVSVDVASDATASSQPDFANLGEESLDDDYSGEPFELSELLPELFPELVARAKPGCMGGSWRACHDWTLRQCPLRCTGLPRRRHPCTQRCIRGADIQCQKACS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.02
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.06
25 0.06
26 0.07
27 0.08
28 0.08
29 0.09
30 0.1
31 0.09
32 0.11
33 0.1
34 0.1
35 0.08
36 0.09
37 0.09
38 0.08
39 0.08
40 0.05
41 0.06
42 0.05
43 0.06
44 0.06
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.08
69 0.07
70 0.11
71 0.16
72 0.21
73 0.22
74 0.23
75 0.24
76 0.24
77 0.25
78 0.25
79 0.28
80 0.29
81 0.36
82 0.4
83 0.45
84 0.47
85 0.48
86 0.5
87 0.47
88 0.42
89 0.42
90 0.48
91 0.5
92 0.57
93 0.64
94 0.68
95 0.69
96 0.78
97 0.8
98 0.79
99 0.81
100 0.82
101 0.83
102 0.78
103 0.75
104 0.69
105 0.68
106 0.63
107 0.62
108 0.6
109 0.57