Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A124BWC2

Protein Details
Accession A0A124BWC2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
194-219ITYKRTPQLDPPPQGKRRKNISRRTTHydrophilic
NLS Segment(s)
PositionSequence
209-212KRRK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MGPTKPVLPPLYTPKNMTFPSELRERTWTCLDIDRPIKEEGKDEETEKVENVTITPPPAYTEFLNTFSPIFSSSTNSRENFYKYMSDKPRPAPSSPPLTATSTTFPSGIPPKTTTAIVPTQAPQVARPTKSPIHAQRMRLPAPYLYTPVSASPRSAHPLRSPFTPSDRRQHFFESPVSENGNTFCVRHIVTTTITYKRTPQLDPPPQGKRRKNISRRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.5
4 0.49
5 0.45
6 0.37
7 0.39
8 0.43
9 0.4
10 0.36
11 0.42
12 0.4
13 0.4
14 0.42
15 0.38
16 0.33
17 0.37
18 0.37
19 0.37
20 0.41
21 0.38
22 0.37
23 0.39
24 0.39
25 0.34
26 0.36
27 0.32
28 0.32
29 0.32
30 0.3
31 0.31
32 0.3
33 0.3
34 0.26
35 0.22
36 0.17
37 0.15
38 0.15
39 0.12
40 0.11
41 0.12
42 0.12
43 0.11
44 0.12
45 0.13
46 0.15
47 0.13
48 0.18
49 0.19
50 0.21
51 0.22
52 0.2
53 0.19
54 0.17
55 0.17
56 0.13
57 0.12
58 0.09
59 0.13
60 0.15
61 0.19
62 0.24
63 0.24
64 0.24
65 0.26
66 0.29
67 0.26
68 0.26
69 0.27
70 0.24
71 0.33
72 0.38
73 0.41
74 0.42
75 0.45
76 0.52
77 0.49
78 0.49
79 0.46
80 0.43
81 0.46
82 0.42
83 0.4
84 0.33
85 0.33
86 0.32
87 0.27
88 0.25
89 0.18
90 0.18
91 0.15
92 0.13
93 0.14
94 0.17
95 0.16
96 0.16
97 0.16
98 0.17
99 0.18
100 0.19
101 0.16
102 0.15
103 0.16
104 0.15
105 0.14
106 0.13
107 0.14
108 0.15
109 0.15
110 0.12
111 0.18
112 0.21
113 0.22
114 0.23
115 0.26
116 0.28
117 0.3
118 0.37
119 0.37
120 0.43
121 0.46
122 0.49
123 0.51
124 0.55
125 0.54
126 0.47
127 0.42
128 0.33
129 0.32
130 0.29
131 0.24
132 0.19
133 0.18
134 0.17
135 0.18
136 0.2
137 0.17
138 0.17
139 0.16
140 0.18
141 0.23
142 0.24
143 0.25
144 0.27
145 0.33
146 0.34
147 0.36
148 0.37
149 0.35
150 0.41
151 0.47
152 0.46
153 0.49
154 0.54
155 0.54
156 0.54
157 0.58
158 0.52
159 0.47
160 0.48
161 0.43
162 0.39
163 0.39
164 0.38
165 0.31
166 0.29
167 0.27
168 0.25
169 0.19
170 0.16
171 0.14
172 0.14
173 0.15
174 0.15
175 0.16
176 0.16
177 0.17
178 0.22
179 0.26
180 0.28
181 0.3
182 0.3
183 0.33
184 0.37
185 0.39
186 0.37
187 0.42
188 0.48
189 0.56
190 0.62
191 0.66
192 0.69
193 0.74
194 0.81
195 0.8
196 0.79
197 0.8
198 0.83
199 0.85