Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A117DYF4

Protein Details
Accession A0A117DYF4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-114KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11.833, nucl 4.5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLSFRSVFGASTGALRQILPSFSRRSAALVSRPFSQIARLSLGNGLRLLRSGKQTNNVGVASVGSTLRQVEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.13
5 0.15
6 0.15
7 0.18
8 0.21
9 0.22
10 0.24
11 0.23
12 0.23
13 0.25
14 0.27
15 0.31
16 0.32
17 0.33
18 0.33
19 0.34
20 0.32
21 0.29
22 0.27
23 0.23
24 0.19
25 0.2
26 0.18
27 0.18
28 0.2
29 0.2
30 0.17
31 0.15
32 0.13
33 0.1
34 0.11
35 0.12
36 0.11
37 0.16
38 0.18
39 0.19
40 0.24
41 0.26
42 0.26
43 0.27
44 0.24
45 0.19
46 0.16
47 0.14
48 0.09
49 0.08
50 0.07
51 0.04
52 0.05
53 0.05
54 0.05
55 0.09
56 0.1
57 0.1
58 0.18
59 0.22
60 0.24
61 0.26
62 0.27
63 0.25
64 0.28
65 0.36
66 0.35
67 0.38
68 0.4
69 0.41
70 0.49
71 0.51
72 0.52
73 0.51
74 0.53
75 0.55
76 0.6
77 0.65
78 0.66
79 0.73
80 0.78
81 0.77
82 0.79
83 0.8
84 0.79
85 0.78
86 0.78
87 0.76
88 0.77
89 0.79
90 0.75
91 0.75
92 0.77
93 0.81
94 0.82