Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A100IKW9

Protein Details
Accession A0A100IKW9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-113IQENEKAPKPRPKKHRELKTDFDQEVHydrophilic
NLS Segment(s)
PositionSequence
93-103KAPKPRPKKHR
Subcellular Location(s) cyto 14.5, cyto_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002125  CMP_dCMP_dom  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF00383  dCMP_cyt_deam_1  
PROSITE View protein in PROSITE  
PS51747  CYT_DCMP_DEAMINASES_2  
Amino Acid Sequences MEMSGDMPPELLENNAEHAYFMKQALMMGEKALATGETPVGCVLVYDNKIVGSGMNDTNKSMNVDPPYPVQGGLFHKEAIMLLRRFYIQENEKAPKPRPKKHRELKTDFDQEVLIASPTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.12
5 0.13
6 0.14
7 0.14
8 0.14
9 0.11
10 0.1
11 0.11
12 0.12
13 0.13
14 0.11
15 0.1
16 0.1
17 0.09
18 0.09
19 0.08
20 0.07
21 0.05
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.06
31 0.09
32 0.1
33 0.09
34 0.1
35 0.1
36 0.1
37 0.1
38 0.09
39 0.06
40 0.08
41 0.1
42 0.11
43 0.12
44 0.12
45 0.13
46 0.13
47 0.14
48 0.12
49 0.13
50 0.13
51 0.14
52 0.15
53 0.16
54 0.18
55 0.16
56 0.16
57 0.12
58 0.14
59 0.16
60 0.18
61 0.18
62 0.16
63 0.15
64 0.15
65 0.15
66 0.14
67 0.17
68 0.14
69 0.14
70 0.15
71 0.15
72 0.16
73 0.18
74 0.23
75 0.21
76 0.27
77 0.32
78 0.36
79 0.41
80 0.46
81 0.51
82 0.53
83 0.59
84 0.62
85 0.67
86 0.72
87 0.78
88 0.83
89 0.88
90 0.88
91 0.87
92 0.86
93 0.85
94 0.84
95 0.73
96 0.63
97 0.52
98 0.41
99 0.34
100 0.27