Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A100IEC6

Protein Details
Accession A0A100IEC6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
96-115IDSIKPKIREQKQKKPAPAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010625  CHCH  
IPR039289  CHCHD4  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0015035  F:protein-disulfide reductase activity  
GO:0045041  P:protein import into mitochondrial intermembrane space  
Pfam View protein in Pfam  
PF06747  CHCH  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MFRSAPRAILRAPAVAVRGPAARRLISTNTPADSKPRSWKNTAARLGLAIGAVYYYNTSPYFAQTPSYPVQLANNAVSLLSQSNSDSAEAESSLTIDSIKPKIREQKQKKPAPAPTPAAPEAPQDDAQQPSPESASMMSPEELEAEAGQEGAFNPETGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSSEEPKGIDCIEKFKGMQDCFRLHPDVYGAELEDDEEAAAAAAAVPAPEAGDEQPVTAAQIEAASHPEEKRAHAQEINAQTKQELAEKGELAEAETLVPKAAHDAVPQTEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.22
4 0.18
5 0.21
6 0.2
7 0.23
8 0.25
9 0.24
10 0.24
11 0.28
12 0.31
13 0.32
14 0.36
15 0.35
16 0.34
17 0.35
18 0.34
19 0.36
20 0.36
21 0.37
22 0.42
23 0.47
24 0.51
25 0.54
26 0.62
27 0.65
28 0.7
29 0.7
30 0.63
31 0.54
32 0.49
33 0.45
34 0.36
35 0.26
36 0.16
37 0.09
38 0.07
39 0.06
40 0.05
41 0.06
42 0.05
43 0.07
44 0.08
45 0.1
46 0.1
47 0.13
48 0.16
49 0.15
50 0.17
51 0.16
52 0.21
53 0.21
54 0.23
55 0.2
56 0.18
57 0.2
58 0.21
59 0.22
60 0.17
61 0.16
62 0.14
63 0.13
64 0.13
65 0.11
66 0.09
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.09
85 0.13
86 0.18
87 0.19
88 0.24
89 0.34
90 0.43
91 0.53
92 0.6
93 0.67
94 0.73
95 0.79
96 0.81
97 0.79
98 0.78
99 0.73
100 0.7
101 0.64
102 0.57
103 0.54
104 0.48
105 0.41
106 0.34
107 0.29
108 0.24
109 0.22
110 0.2
111 0.16
112 0.16
113 0.16
114 0.17
115 0.17
116 0.15
117 0.13
118 0.12
119 0.1
120 0.09
121 0.08
122 0.07
123 0.07
124 0.08
125 0.08
126 0.07
127 0.07
128 0.07
129 0.07
130 0.06
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.03
137 0.03
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.07
144 0.06
145 0.09
146 0.08
147 0.1
148 0.1
149 0.1
150 0.09
151 0.09
152 0.09
153 0.06
154 0.06
155 0.05
156 0.08
157 0.08
158 0.1
159 0.1
160 0.1
161 0.1
162 0.12
163 0.11
164 0.09
165 0.08
166 0.09
167 0.11
168 0.11
169 0.11
170 0.09
171 0.1
172 0.1
173 0.11
174 0.14
175 0.13
176 0.16
177 0.18
178 0.19
179 0.18
180 0.18
181 0.18
182 0.14
183 0.16
184 0.13
185 0.16
186 0.16
187 0.18
188 0.18
189 0.21
190 0.27
191 0.26
192 0.3
193 0.3
194 0.31
195 0.32
196 0.35
197 0.33
198 0.26
199 0.25
200 0.23
201 0.19
202 0.17
203 0.15
204 0.12
205 0.09
206 0.09
207 0.09
208 0.07
209 0.06
210 0.05
211 0.04
212 0.04
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.05
225 0.05
226 0.08
227 0.08
228 0.08
229 0.09
230 0.09
231 0.1
232 0.09
233 0.08
234 0.06
235 0.07
236 0.07
237 0.07
238 0.09
239 0.1
240 0.12
241 0.13
242 0.18
243 0.19
244 0.22
245 0.3
246 0.33
247 0.36
248 0.36
249 0.38
250 0.4
251 0.49
252 0.52
253 0.44
254 0.4
255 0.35
256 0.34
257 0.34
258 0.31
259 0.24
260 0.21
261 0.24
262 0.24
263 0.25
264 0.25
265 0.23
266 0.19
267 0.18
268 0.14
269 0.11
270 0.12
271 0.11
272 0.1
273 0.1
274 0.09
275 0.11
276 0.14
277 0.15
278 0.15
279 0.19