Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A100I4R6

Protein Details
Accession A0A100I4R6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-140NPPQKRDDGPKPPKNPQPKPQPKPQPKPQPKPKPLDDKPQDPPRPNBasic
NLS Segment(s)
PositionSequence
97-130PQKRDDGPKPPKNPQPKPQPKPQPKPQPKPKPLD
Subcellular Location(s) extr 21, golg 3, nucl 1, mito 1, E.R. 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MKFSAVLSTLLVAGLVAAAPPAPRPTDIQPHHHPNPPPNAPLPKPHDNNKRDGPEPPKDEPTPDAPKPANDAHPHDQPKPVPQPPKDAPLPNNPNPPQKRDDGPKPPKNPQPKPQPKPQPKPQPKPKPLDDKPQDPPRPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.07
9 0.09
10 0.1
11 0.14
12 0.2
13 0.3
14 0.34
15 0.41
16 0.47
17 0.55
18 0.58
19 0.6
20 0.59
21 0.55
22 0.6
23 0.56
24 0.51
25 0.47
26 0.5
27 0.45
28 0.5
29 0.51
30 0.51
31 0.51
32 0.58
33 0.62
34 0.58
35 0.63
36 0.63
37 0.6
38 0.52
39 0.54
40 0.51
41 0.49
42 0.52
43 0.49
44 0.46
45 0.42
46 0.42
47 0.38
48 0.38
49 0.37
50 0.31
51 0.33
52 0.28
53 0.28
54 0.3
55 0.3
56 0.28
57 0.23
58 0.29
59 0.29
60 0.36
61 0.38
62 0.36
63 0.37
64 0.34
65 0.37
66 0.39
67 0.4
68 0.41
69 0.39
70 0.46
71 0.45
72 0.5
73 0.48
74 0.45
75 0.43
76 0.46
77 0.52
78 0.49
79 0.56
80 0.53
81 0.59
82 0.58
83 0.59
84 0.52
85 0.48
86 0.49
87 0.48
88 0.54
89 0.56
90 0.63
91 0.68
92 0.71
93 0.75
94 0.78
95 0.8
96 0.8
97 0.78
98 0.79
99 0.81
100 0.81
101 0.83
102 0.86
103 0.86
104 0.88
105 0.89
106 0.89
107 0.89
108 0.93
109 0.94
110 0.94
111 0.92
112 0.91
113 0.89
114 0.89
115 0.84
116 0.85
117 0.81
118 0.78
119 0.79
120 0.81