Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JNW9

Protein Details
Accession G3JNW9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-74GPKAKISSKKARKLQKKLGYHydrophilic
NLS Segment(s)
PositionSequence
12-31KNRLAARAAKARKTSQKRSA
56-72PKAKISSKKARKLQKKL
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG cmt:CCM_07831  -  
Amino Acid Sequences MPSVKNPNGPSKNRLAARAAKARKTSQKRSAELKYQIPKLDALRGARPGLLPNCGPKAKISSKKARKLQKKLGYALQRKAAAEGGDATMADATKGGEEVREGPDETEMEGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.52
4 0.55
5 0.6
6 0.57
7 0.55
8 0.58
9 0.62
10 0.66
11 0.67
12 0.69
13 0.69
14 0.72
15 0.71
16 0.73
17 0.72
18 0.7
19 0.67
20 0.65
21 0.62
22 0.57
23 0.54
24 0.47
25 0.43
26 0.36
27 0.35
28 0.3
29 0.25
30 0.24
31 0.25
32 0.24
33 0.22
34 0.21
35 0.2
36 0.17
37 0.17
38 0.15
39 0.15
40 0.19
41 0.19
42 0.19
43 0.16
44 0.21
45 0.27
46 0.35
47 0.39
48 0.46
49 0.55
50 0.64
51 0.71
52 0.74
53 0.77
54 0.78
55 0.82
56 0.8
57 0.77
58 0.72
59 0.72
60 0.72
61 0.68
62 0.63
63 0.58
64 0.51
65 0.45
66 0.43
67 0.37
68 0.27
69 0.21
70 0.18
71 0.13
72 0.11
73 0.1
74 0.09
75 0.08
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.05
84 0.07
85 0.1
86 0.13
87 0.15
88 0.16
89 0.16
90 0.18
91 0.18
92 0.18