Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JJ68

Protein Details
Accession G3JJ68    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-39TEEFRRVKRRQDRSAPGAGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 5, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
KEGG cmt:CCM_06170  -  
Pfam View protein in Pfam  
PF01423  LSM  
Amino Acid Sequences MSNKQGKMAGYHMNLVLADTEEFRRVKRRQDRSAPGAGGSLVESEEKRTLGLTIVRGAYIVSLSVESPPPADPSARLGKSAPGGIASALSAGPGVAKPAGRGAPAPSLAVRNQPHSQTANRVAVANFLQGPALGMGGGAPPGLPGFPGPPGFAGRGGPSPFPGGFPPPAGFPGAPPGGFPPHGFQPPPGGAPPGFNPGPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.2
4 0.13
5 0.11
6 0.11
7 0.12
8 0.16
9 0.16
10 0.18
11 0.27
12 0.29
13 0.39
14 0.48
15 0.56
16 0.62
17 0.72
18 0.79
19 0.76
20 0.81
21 0.71
22 0.61
23 0.51
24 0.41
25 0.31
26 0.22
27 0.15
28 0.08
29 0.09
30 0.08
31 0.1
32 0.12
33 0.11
34 0.11
35 0.11
36 0.11
37 0.12
38 0.15
39 0.13
40 0.15
41 0.15
42 0.15
43 0.15
44 0.14
45 0.11
46 0.09
47 0.07
48 0.04
49 0.04
50 0.05
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.1
57 0.1
58 0.1
59 0.1
60 0.14
61 0.22
62 0.22
63 0.22
64 0.2
65 0.22
66 0.23
67 0.23
68 0.18
69 0.1
70 0.1
71 0.09
72 0.08
73 0.06
74 0.05
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.05
85 0.07
86 0.08
87 0.08
88 0.08
89 0.1
90 0.11
91 0.11
92 0.12
93 0.1
94 0.12
95 0.12
96 0.18
97 0.17
98 0.2
99 0.22
100 0.22
101 0.25
102 0.25
103 0.26
104 0.26
105 0.3
106 0.28
107 0.26
108 0.26
109 0.23
110 0.23
111 0.22
112 0.17
113 0.12
114 0.09
115 0.09
116 0.07
117 0.08
118 0.06
119 0.05
120 0.04
121 0.03
122 0.03
123 0.03
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.05
133 0.08
134 0.09
135 0.09
136 0.1
137 0.12
138 0.13
139 0.14
140 0.14
141 0.13
142 0.17
143 0.19
144 0.18
145 0.18
146 0.2
147 0.19
148 0.2
149 0.2
150 0.19
151 0.18
152 0.2
153 0.2
154 0.18
155 0.19
156 0.2
157 0.18
158 0.15
159 0.2
160 0.2
161 0.18
162 0.18
163 0.2
164 0.21
165 0.23
166 0.23
167 0.21
168 0.25
169 0.3
170 0.3
171 0.28
172 0.32
173 0.33
174 0.35
175 0.32
176 0.29
177 0.25
178 0.28
179 0.3
180 0.29
181 0.28