Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J6A3

Protein Details
Accession G3J6A3    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
75-117DAIREKRTKKAEKERYEKLAEKMHKKRVERLKRKEKRNKLISSBasic
NLS Segment(s)
PositionSequence
54-114QMKAKENEMKAEKKAERQRKVDAIREKRTKKAEKERYEKLAEKMHKKRVERLKRKEKRNKL
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG cmt:CCM_01661  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTEPISLSAVTQADKPLGMRKNGKQWHALKKAFRPTAGLTTFEKRTKERAQMAQMKAKENEMKAEKKAERQRKVDAIREKRTKKAEKERYEKLAEKMHKKRVERLKRKEKRNKLISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.19
4 0.23
5 0.29
6 0.35
7 0.39
8 0.49
9 0.54
10 0.56
11 0.57
12 0.6
13 0.65
14 0.67
15 0.67
16 0.63
17 0.65
18 0.71
19 0.65
20 0.58
21 0.51
22 0.44
23 0.47
24 0.42
25 0.36
26 0.29
27 0.31
28 0.35
29 0.34
30 0.34
31 0.27
32 0.33
33 0.36
34 0.4
35 0.42
36 0.43
37 0.48
38 0.54
39 0.56
40 0.55
41 0.52
42 0.48
43 0.42
44 0.39
45 0.33
46 0.25
47 0.27
48 0.25
49 0.26
50 0.24
51 0.31
52 0.3
53 0.36
54 0.45
55 0.5
56 0.53
57 0.54
58 0.58
59 0.6
60 0.63
61 0.63
62 0.63
63 0.63
64 0.65
65 0.71
66 0.69
67 0.67
68 0.72
69 0.72
70 0.72
71 0.74
72 0.75
73 0.75
74 0.8
75 0.8
76 0.78
77 0.76
78 0.7
79 0.64
80 0.62
81 0.6
82 0.63
83 0.64
84 0.67
85 0.68
86 0.67
87 0.72
88 0.74
89 0.77
90 0.78
91 0.8
92 0.82
93 0.84
94 0.92
95 0.94
96 0.94
97 0.93