Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A117DXX9

Protein Details
Accession A0A117DXX9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGQRHNRRRTRPRSRNRSVNPLLLHydrophilic
NLS Segment(s)
PositionSequence
7-14RRRTRPRS
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGQRHNRRRTRPRSRNRSVNPLLLPSHPFPRPVNTCAPAVPSAFDCPEIPAPTWHYGHLLGQKRDRALRMEASTLEAEQYRLFGGVPGDDVGLCYRMLEYFGGLDYIDCPQSLNALPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.9
4 0.89
5 0.83
6 0.79
7 0.7
8 0.63
9 0.55
10 0.46
11 0.44
12 0.36
13 0.36
14 0.3
15 0.31
16 0.28
17 0.34
18 0.37
19 0.36
20 0.4
21 0.37
22 0.36
23 0.34
24 0.35
25 0.28
26 0.23
27 0.2
28 0.15
29 0.15
30 0.14
31 0.14
32 0.12
33 0.12
34 0.15
35 0.15
36 0.15
37 0.14
38 0.17
39 0.19
40 0.2
41 0.18
42 0.16
43 0.15
44 0.17
45 0.23
46 0.25
47 0.25
48 0.28
49 0.29
50 0.3
51 0.31
52 0.31
53 0.26
54 0.23
55 0.25
56 0.24
57 0.23
58 0.22
59 0.22
60 0.21
61 0.18
62 0.16
63 0.11
64 0.1
65 0.09
66 0.09
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.07
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.09
94 0.09
95 0.09
96 0.09
97 0.09
98 0.12