Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JB20

Protein Details
Accession G3JB20    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
63-82LVPWTRRARHWRASRRPVASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 5, cyto 4, plas 2
Family & Domain DBs
KEGG cmt:CCM_03504  -  
Amino Acid Sequences MSTCKLLLISAPRFMQSGIIPNVDLFQCQNDDPTDKRTMGSRYTITCVSGLSTAVRPNHGNVLVPWTRRARHWRASRRPVASDAPPLSLPGLTKLGKPAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.18
4 0.23
5 0.2
6 0.2
7 0.19
8 0.19
9 0.21
10 0.18
11 0.17
12 0.1
13 0.1
14 0.11
15 0.11
16 0.12
17 0.12
18 0.15
19 0.16
20 0.2
21 0.22
22 0.21
23 0.21
24 0.23
25 0.25
26 0.24
27 0.26
28 0.24
29 0.22
30 0.24
31 0.24
32 0.21
33 0.18
34 0.16
35 0.13
36 0.11
37 0.09
38 0.07
39 0.08
40 0.1
41 0.11
42 0.13
43 0.13
44 0.13
45 0.16
46 0.16
47 0.15
48 0.13
49 0.19
50 0.2
51 0.21
52 0.24
53 0.25
54 0.25
55 0.3
56 0.39
57 0.39
58 0.46
59 0.56
60 0.63
61 0.7
62 0.79
63 0.82
64 0.78
65 0.74
66 0.69
67 0.63
68 0.56
69 0.54
70 0.45
71 0.4
72 0.35
73 0.32
74 0.28
75 0.24
76 0.21
77 0.16
78 0.2
79 0.18
80 0.19