Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J3S6

Protein Details
Accession G3J3S6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-52GKKTAASGEKKKRSKSRKETYSSYIHydrophilic
NLS Segment(s)
PositionSequence
5-45AADKKPASKAPATASKAPEKKDAGKKTAASGEKKKRSKSRK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
KEGG cmt:CCM_01208  -  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MPPKAADKKPASKAPATASKAPEKKDAGKKTAASGEKKKRSKSRKETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKFISSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.57
4 0.54
5 0.52
6 0.56
7 0.57
8 0.56
9 0.56
10 0.51
11 0.54
12 0.59
13 0.61
14 0.56
15 0.57
16 0.55
17 0.53
18 0.56
19 0.52
20 0.49
21 0.52
22 0.58
23 0.62
24 0.67
25 0.71
26 0.73
27 0.78
28 0.82
29 0.82
30 0.83
31 0.82
32 0.83
33 0.8
34 0.76
35 0.75
36 0.65
37 0.57
38 0.53
39 0.44
40 0.39
41 0.38
42 0.37
43 0.31
44 0.34
45 0.33
46 0.3
47 0.31
48 0.29
49 0.26
50 0.24
51 0.24
52 0.19
53 0.17
54 0.13
55 0.12
56 0.12
57 0.1
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.09
65 0.09
66 0.08
67 0.07
68 0.06
69 0.07
70 0.07
71 0.08
72 0.06
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.12
79 0.17
80 0.19
81 0.23
82 0.25
83 0.27
84 0.28
85 0.3
86 0.32
87 0.32
88 0.34
89 0.33
90 0.35
91 0.34
92 0.34
93 0.34
94 0.3
95 0.25
96 0.22
97 0.19
98 0.15
99 0.14
100 0.16
101 0.14
102 0.13
103 0.13
104 0.13
105 0.13
106 0.12
107 0.12
108 0.11
109 0.1
110 0.11
111 0.12
112 0.14
113 0.17
114 0.16
115 0.18
116 0.18
117 0.18