Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A100IAI5

Protein Details
Accession A0A100IAI5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-97APDTPATGEKRKRGRPRKYPEGSTPKRPDGPKRGRGRPRKDPNAPTPSKSTTPKQGKRGRPRKTPVENGTBasic
NLS Segment(s)
PositionSequence
35-90GEKRKRGRPRKYPEGSTPKRPDGPKRGRGRPRKDPNAPTPSKSTTPKQGKRGRPRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR002740  EVE_domain  
IPR000116  HMGA  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
PF01878  EVE  
CDD cd21133  EVE  
Amino Acid Sequences MAPQRKRKSESASIAEEAESPAAKRVAAPDTPATGEKRKRGRPRKYPEGSTPKRPDGPKRGRGRPRKDPNAPTPSKSTTPKQGKRGRPRKTPVENGTEPTPSTTKTETVDTTPFEGRSYWLMKAEPDSRLEKGVDVKFSIDDLAARKEPEPWDGVRNPVAQKHIRDMKKGDLAFFYHSNCKVPGIAGIMEIVKEHSPDESAFDPAHPYYDEKSNRDDPKWQVVHVEFRRKFNKMITLNDLKSYAQSVRALENMQVLKQSRLSVTPVSVTEWAFIMGVAEENEAKTNAEASKDDSAEGEEPESSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.49
3 0.4
4 0.31
5 0.23
6 0.17
7 0.12
8 0.15
9 0.14
10 0.13
11 0.14
12 0.17
13 0.21
14 0.21
15 0.25
16 0.24
17 0.26
18 0.28
19 0.3
20 0.31
21 0.35
22 0.4
23 0.45
24 0.51
25 0.59
26 0.67
27 0.75
28 0.82
29 0.84
30 0.87
31 0.9
32 0.89
33 0.86
34 0.86
35 0.86
36 0.82
37 0.82
38 0.79
39 0.75
40 0.74
41 0.72
42 0.71
43 0.71
44 0.75
45 0.73
46 0.75
47 0.79
48 0.82
49 0.87
50 0.87
51 0.87
52 0.87
53 0.88
54 0.88
55 0.86
56 0.86
57 0.86
58 0.8
59 0.72
60 0.67
61 0.62
62 0.58
63 0.54
64 0.49
65 0.49
66 0.56
67 0.6
68 0.65
69 0.69
70 0.74
71 0.8
72 0.86
73 0.85
74 0.84
75 0.84
76 0.85
77 0.84
78 0.83
79 0.78
80 0.76
81 0.69
82 0.62
83 0.57
84 0.47
85 0.38
86 0.31
87 0.26
88 0.18
89 0.2
90 0.18
91 0.17
92 0.18
93 0.2
94 0.19
95 0.21
96 0.22
97 0.2
98 0.21
99 0.21
100 0.19
101 0.17
102 0.16
103 0.14
104 0.16
105 0.17
106 0.15
107 0.15
108 0.15
109 0.15
110 0.19
111 0.21
112 0.19
113 0.2
114 0.21
115 0.2
116 0.22
117 0.21
118 0.18
119 0.21
120 0.21
121 0.19
122 0.17
123 0.17
124 0.15
125 0.15
126 0.14
127 0.08
128 0.07
129 0.08
130 0.11
131 0.11
132 0.12
133 0.12
134 0.14
135 0.15
136 0.16
137 0.16
138 0.14
139 0.18
140 0.18
141 0.2
142 0.2
143 0.22
144 0.21
145 0.21
146 0.25
147 0.23
148 0.24
149 0.29
150 0.35
151 0.34
152 0.36
153 0.36
154 0.36
155 0.4
156 0.39
157 0.33
158 0.26
159 0.26
160 0.25
161 0.24
162 0.21
163 0.2
164 0.2
165 0.2
166 0.19
167 0.18
168 0.15
169 0.14
170 0.13
171 0.11
172 0.11
173 0.09
174 0.1
175 0.09
176 0.08
177 0.08
178 0.08
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.07
185 0.11
186 0.1
187 0.12
188 0.12
189 0.12
190 0.14
191 0.12
192 0.14
193 0.11
194 0.12
195 0.13
196 0.22
197 0.26
198 0.26
199 0.32
200 0.39
201 0.43
202 0.43
203 0.47
204 0.43
205 0.49
206 0.48
207 0.43
208 0.4
209 0.37
210 0.46
211 0.46
212 0.53
213 0.45
214 0.51
215 0.57
216 0.53
217 0.54
218 0.49
219 0.52
220 0.46
221 0.48
222 0.49
223 0.51
224 0.5
225 0.49
226 0.45
227 0.36
228 0.31
229 0.28
230 0.22
231 0.17
232 0.19
233 0.18
234 0.19
235 0.21
236 0.21
237 0.19
238 0.24
239 0.22
240 0.2
241 0.23
242 0.23
243 0.23
244 0.24
245 0.25
246 0.21
247 0.22
248 0.25
249 0.23
250 0.22
251 0.23
252 0.22
253 0.22
254 0.23
255 0.22
256 0.19
257 0.17
258 0.16
259 0.13
260 0.12
261 0.09
262 0.07
263 0.08
264 0.08
265 0.08
266 0.08
267 0.09
268 0.11
269 0.11
270 0.11
271 0.11
272 0.13
273 0.14
274 0.16
275 0.16
276 0.2
277 0.25
278 0.25
279 0.25
280 0.22
281 0.25
282 0.23
283 0.23
284 0.2