Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A100INW3

Protein Details
Accession A0A100INW3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-89ELLAGGKKDKKKDTKGNVKKBasic
NLS Segment(s)
PositionSequence
8-39KKPAGNSGNLVKRPSALGPKRGPRQIAPKKTT
74-89GGKKDKKKDTKGNVKK
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQGSLKKKPAGNSGNLVKRPSALGPKRGPRQIAPKKTTLVKQQKLTKKLTAGLVARTEKNLAEKAGHLELLAGGKKDKKKDTKGNVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.59
4 0.55
5 0.45
6 0.4
7 0.37
8 0.33
9 0.35
10 0.31
11 0.37
12 0.43
13 0.51
14 0.57
15 0.59
16 0.58
17 0.52
18 0.58
19 0.6
20 0.62
21 0.58
22 0.54
23 0.54
24 0.55
25 0.54
26 0.54
27 0.54
28 0.5
29 0.53
30 0.58
31 0.62
32 0.63
33 0.63
34 0.55
35 0.47
36 0.44
37 0.39
38 0.36
39 0.3
40 0.27
41 0.28
42 0.28
43 0.26
44 0.24
45 0.23
46 0.18
47 0.2
48 0.19
49 0.15
50 0.14
51 0.15
52 0.18
53 0.18
54 0.18
55 0.14
56 0.13
57 0.13
58 0.15
59 0.15
60 0.12
61 0.13
62 0.2
63 0.25
64 0.32
65 0.41
66 0.48
67 0.56
68 0.66
69 0.75