Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A100IHL6

Protein Details
Accession A0A100IHL6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
342-363EQPTGEGRRRSKRLDSRRINPAHydrophilic
NLS Segment(s)
PositionSequence
28-51SRRKAAAKIKRKPVGAAAAAAPKT
336-338KRK
346-359GEGRRRSKRLDSRR
Subcellular Location(s) cyto 20, mito 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
Amino Acid Sequences MDLHPQTITPQTFQHLLSLYPKKVDLLSRRKAAAKIKRKPVGAAAAAAPKTKQKSSWTATGTRSEAEEEFITAKANEFLALDGFRYEGLPGMVATRAEKDGNGYLEKDELVKLMEWKMQHGTFRPALLGMIRSNSEAVVRDATGKAFKALTAHHTSKEGDEEEKKFPSEALDILTKALRGVGVATASLVLSLASTADVPFYSDDVYLWVCMEEVPSPSTSGSGEGEAQAEAEAEAADRVKRGVYKRLNGELNVKYTMKEYRELWEGVKGLKERLEGKEKGVSGLDVEKVALVVRYYYALLGGGQSVDGDGDGGGGDKKRSEGMKVEEEEETTKREKRKLEDEQPTGEGRRRSKRLDSRRINPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.24
3 0.24
4 0.31
5 0.36
6 0.34
7 0.34
8 0.34
9 0.31
10 0.34
11 0.4
12 0.41
13 0.43
14 0.5
15 0.53
16 0.57
17 0.6
18 0.63
19 0.64
20 0.65
21 0.66
22 0.67
23 0.72
24 0.75
25 0.72
26 0.69
27 0.65
28 0.63
29 0.54
30 0.46
31 0.39
32 0.39
33 0.38
34 0.36
35 0.3
36 0.28
37 0.31
38 0.3
39 0.31
40 0.31
41 0.39
42 0.44
43 0.52
44 0.5
45 0.52
46 0.53
47 0.55
48 0.5
49 0.41
50 0.37
51 0.31
52 0.27
53 0.23
54 0.2
55 0.15
56 0.15
57 0.14
58 0.14
59 0.12
60 0.12
61 0.11
62 0.1
63 0.09
64 0.08
65 0.09
66 0.09
67 0.09
68 0.09
69 0.08
70 0.08
71 0.07
72 0.08
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.09
82 0.1
83 0.11
84 0.11
85 0.11
86 0.13
87 0.15
88 0.18
89 0.18
90 0.17
91 0.16
92 0.16
93 0.17
94 0.15
95 0.11
96 0.09
97 0.09
98 0.09
99 0.1
100 0.12
101 0.14
102 0.13
103 0.15
104 0.19
105 0.19
106 0.21
107 0.22
108 0.25
109 0.24
110 0.24
111 0.22
112 0.18
113 0.17
114 0.16
115 0.15
116 0.1
117 0.1
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.09
124 0.1
125 0.1
126 0.09
127 0.11
128 0.11
129 0.12
130 0.12
131 0.11
132 0.11
133 0.1
134 0.1
135 0.1
136 0.1
137 0.15
138 0.21
139 0.22
140 0.22
141 0.24
142 0.24
143 0.23
144 0.25
145 0.2
146 0.16
147 0.19
148 0.22
149 0.23
150 0.23
151 0.23
152 0.2
153 0.19
154 0.17
155 0.14
156 0.11
157 0.11
158 0.11
159 0.1
160 0.11
161 0.11
162 0.09
163 0.08
164 0.08
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.03
176 0.03
177 0.02
178 0.02
179 0.02
180 0.02
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.05
187 0.05
188 0.06
189 0.05
190 0.05
191 0.06
192 0.07
193 0.06
194 0.06
195 0.06
196 0.05
197 0.05
198 0.06
199 0.05
200 0.06
201 0.08
202 0.08
203 0.09
204 0.09
205 0.09
206 0.09
207 0.09
208 0.08
209 0.08
210 0.08
211 0.08
212 0.08
213 0.08
214 0.08
215 0.06
216 0.06
217 0.05
218 0.04
219 0.04
220 0.03
221 0.04
222 0.04
223 0.05
224 0.05
225 0.05
226 0.06
227 0.11
228 0.14
229 0.24
230 0.3
231 0.36
232 0.42
233 0.48
234 0.5
235 0.47
236 0.51
237 0.45
238 0.41
239 0.38
240 0.33
241 0.26
242 0.26
243 0.29
244 0.24
245 0.24
246 0.22
247 0.23
248 0.27
249 0.28
250 0.26
251 0.26
252 0.25
253 0.22
254 0.26
255 0.23
256 0.2
257 0.22
258 0.24
259 0.23
260 0.28
261 0.35
262 0.31
263 0.33
264 0.38
265 0.35
266 0.34
267 0.31
268 0.25
269 0.19
270 0.2
271 0.18
272 0.12
273 0.12
274 0.1
275 0.1
276 0.1
277 0.09
278 0.06
279 0.06
280 0.06
281 0.08
282 0.08
283 0.08
284 0.08
285 0.07
286 0.07
287 0.07
288 0.07
289 0.06
290 0.05
291 0.05
292 0.05
293 0.05
294 0.04
295 0.04
296 0.03
297 0.03
298 0.03
299 0.04
300 0.06
301 0.08
302 0.09
303 0.09
304 0.11
305 0.15
306 0.17
307 0.2
308 0.25
309 0.3
310 0.38
311 0.4
312 0.41
313 0.38
314 0.38
315 0.38
316 0.32
317 0.3
318 0.26
319 0.3
320 0.33
321 0.39
322 0.44
323 0.48
324 0.57
325 0.64
326 0.7
327 0.75
328 0.74
329 0.73
330 0.69
331 0.65
332 0.58
333 0.53
334 0.5
335 0.48
336 0.53
337 0.55
338 0.58
339 0.65
340 0.73
341 0.78
342 0.82
343 0.84