Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BN16

Protein Details
Accession A0A0P1BN16    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-77LPVEERGYRSRRKQCQKQRFSTGRVAWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MLRHITCSTKVRSKDLSKHRRSSAIQRSASACFQNFPAAGSQSRSELRIGLPVEERGYRSRRKQCQKQRFSTGRVAWYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.72
4 0.72
5 0.77
6 0.74
7 0.73
8 0.69
9 0.7
10 0.69
11 0.68
12 0.6
13 0.54
14 0.53
15 0.48
16 0.46
17 0.37
18 0.27
19 0.18
20 0.17
21 0.17
22 0.15
23 0.13
24 0.12
25 0.11
26 0.11
27 0.12
28 0.12
29 0.12
30 0.13
31 0.14
32 0.13
33 0.12
34 0.12
35 0.15
36 0.15
37 0.14
38 0.15
39 0.15
40 0.17
41 0.17
42 0.19
43 0.19
44 0.24
45 0.3
46 0.38
47 0.47
48 0.56
49 0.66
50 0.75
51 0.81
52 0.87
53 0.9
54 0.9
55 0.91
56 0.88
57 0.83
58 0.82
59 0.76