Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BMP2

Protein Details
Accession A0A0P1BMP2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-34MDAARKAARKRELERNKASRQKVRDEHydrophilic
NLS Segment(s)
PositionSequence
12-32ARKAARKRELERNKASRQKVR
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019007  WW_dom-bd_prot_11  
Gene Ontology GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF12622  NpwBP  
PF09429  Wbp11  
Amino Acid Sequences MAKKSSNPMDAARKAARKRELERNKASRQKVRDEIMIRKDPRPLQAEVRRLERLSSTGNGKLSAIDSNELKEKRAELEAMLRLKEEFVAKHPNSRKLVFPGEEEERAEKERQRKAEEESKMAAGAGKASSGPAGGGQYAGIIPERSVYYDPVFNPTGAPPPGMPYREKPPDQWPAPPLPSSPPPSWPTTFDTRFEAQAGEEKADVLSGDEVGTSNSDTDSDSNSDEDGIQLPEGPPPLPPAADVEVKEESEEDDDDDDDGIVMPSGPPPPKVGSNVPAGPTQMHYTGPPPGFGTHSGTDMPLAAPNWTSHGPMSGPGPFPAGLSDQMRPPTWQAGPSQFRPPPPMRPFPRAGAPRGFEGYAAHAGAGGGVRADPMALNGEVRPTYQSWRARPRPSPHTLHPSPSGPNSVPARAPTGPSASSAAASHHSRPRAPGPPPVRPPTSISAAPQMRDFRKEAAEFVPPALARKRAAQRAQAAKGGLPGMVDAAPASGPRADQQEATSSKDDTQRIGLMDRLKPHLNTSRDAQEASPRSGQAPGRRKKDDEYERFLGDIGDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.66
4 0.65
5 0.69
6 0.73
7 0.76
8 0.78
9 0.82
10 0.83
11 0.84
12 0.85
13 0.87
14 0.84
15 0.81
16 0.8
17 0.77
18 0.73
19 0.71
20 0.67
21 0.68
22 0.68
23 0.7
24 0.65
25 0.6
26 0.63
27 0.59
28 0.6
29 0.55
30 0.5
31 0.51
32 0.56
33 0.61
34 0.58
35 0.6
36 0.57
37 0.53
38 0.5
39 0.42
40 0.36
41 0.32
42 0.32
43 0.31
44 0.3
45 0.31
46 0.3
47 0.28
48 0.26
49 0.23
50 0.22
51 0.19
52 0.18
53 0.17
54 0.19
55 0.27
56 0.26
57 0.26
58 0.25
59 0.25
60 0.25
61 0.27
62 0.26
63 0.2
64 0.26
65 0.31
66 0.32
67 0.31
68 0.28
69 0.25
70 0.25
71 0.25
72 0.21
73 0.16
74 0.17
75 0.28
76 0.28
77 0.37
78 0.44
79 0.5
80 0.53
81 0.53
82 0.53
83 0.49
84 0.56
85 0.48
86 0.44
87 0.41
88 0.41
89 0.41
90 0.38
91 0.34
92 0.29
93 0.3
94 0.31
95 0.31
96 0.35
97 0.4
98 0.45
99 0.48
100 0.49
101 0.53
102 0.58
103 0.57
104 0.53
105 0.49
106 0.43
107 0.37
108 0.34
109 0.28
110 0.18
111 0.16
112 0.11
113 0.09
114 0.08
115 0.08
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.07
131 0.08
132 0.1
133 0.11
134 0.13
135 0.14
136 0.18
137 0.18
138 0.21
139 0.22
140 0.2
141 0.2
142 0.19
143 0.23
144 0.19
145 0.2
146 0.15
147 0.18
148 0.23
149 0.24
150 0.25
151 0.23
152 0.31
153 0.38
154 0.4
155 0.39
156 0.43
157 0.5
158 0.5
159 0.51
160 0.46
161 0.44
162 0.45
163 0.42
164 0.36
165 0.31
166 0.34
167 0.35
168 0.32
169 0.32
170 0.33
171 0.37
172 0.37
173 0.36
174 0.35
175 0.38
176 0.39
177 0.35
178 0.37
179 0.33
180 0.33
181 0.3
182 0.25
183 0.17
184 0.2
185 0.19
186 0.15
187 0.13
188 0.13
189 0.12
190 0.11
191 0.11
192 0.06
193 0.05
194 0.04
195 0.04
196 0.04
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.06
206 0.08
207 0.09
208 0.1
209 0.1
210 0.1
211 0.1
212 0.09
213 0.09
214 0.08
215 0.07
216 0.06
217 0.07
218 0.07
219 0.08
220 0.09
221 0.08
222 0.07
223 0.09
224 0.1
225 0.09
226 0.09
227 0.11
228 0.13
229 0.15
230 0.15
231 0.15
232 0.16
233 0.16
234 0.15
235 0.13
236 0.11
237 0.1
238 0.09
239 0.07
240 0.06
241 0.07
242 0.07
243 0.07
244 0.06
245 0.05
246 0.05
247 0.04
248 0.03
249 0.03
250 0.03
251 0.04
252 0.07
253 0.08
254 0.08
255 0.1
256 0.12
257 0.14
258 0.17
259 0.18
260 0.18
261 0.22
262 0.23
263 0.23
264 0.22
265 0.2
266 0.17
267 0.16
268 0.15
269 0.12
270 0.11
271 0.1
272 0.1
273 0.15
274 0.15
275 0.14
276 0.14
277 0.13
278 0.14
279 0.15
280 0.18
281 0.13
282 0.14
283 0.14
284 0.13
285 0.13
286 0.12
287 0.11
288 0.08
289 0.07
290 0.06
291 0.07
292 0.07
293 0.1
294 0.1
295 0.1
296 0.09
297 0.1
298 0.1
299 0.1
300 0.12
301 0.12
302 0.12
303 0.11
304 0.13
305 0.12
306 0.11
307 0.12
308 0.11
309 0.11
310 0.12
311 0.13
312 0.14
313 0.16
314 0.16
315 0.16
316 0.16
317 0.18
318 0.17
319 0.18
320 0.18
321 0.25
322 0.29
323 0.31
324 0.37
325 0.35
326 0.36
327 0.41
328 0.42
329 0.43
330 0.45
331 0.52
332 0.5
333 0.54
334 0.56
335 0.51
336 0.57
337 0.5
338 0.48
339 0.43
340 0.4
341 0.35
342 0.34
343 0.31
344 0.23
345 0.2
346 0.19
347 0.15
348 0.13
349 0.11
350 0.09
351 0.08
352 0.09
353 0.08
354 0.05
355 0.03
356 0.03
357 0.03
358 0.03
359 0.03
360 0.03
361 0.04
362 0.06
363 0.06
364 0.07
365 0.07
366 0.09
367 0.09
368 0.1
369 0.12
370 0.11
371 0.14
372 0.22
373 0.28
374 0.34
375 0.45
376 0.52
377 0.58
378 0.65
379 0.69
380 0.7
381 0.71
382 0.7
383 0.67
384 0.68
385 0.63
386 0.6
387 0.56
388 0.5
389 0.45
390 0.41
391 0.38
392 0.29
393 0.33
394 0.31
395 0.29
396 0.28
397 0.26
398 0.29
399 0.25
400 0.27
401 0.22
402 0.23
403 0.21
404 0.21
405 0.22
406 0.17
407 0.17
408 0.16
409 0.15
410 0.17
411 0.19
412 0.23
413 0.26
414 0.28
415 0.29
416 0.33
417 0.38
418 0.42
419 0.42
420 0.46
421 0.48
422 0.55
423 0.61
424 0.63
425 0.59
426 0.54
427 0.55
428 0.5
429 0.49
430 0.41
431 0.35
432 0.38
433 0.37
434 0.36
435 0.36
436 0.38
437 0.36
438 0.38
439 0.38
440 0.32
441 0.36
442 0.36
443 0.34
444 0.3
445 0.32
446 0.29
447 0.28
448 0.28
449 0.22
450 0.25
451 0.25
452 0.26
453 0.22
454 0.3
455 0.38
456 0.43
457 0.49
458 0.52
459 0.58
460 0.64
461 0.66
462 0.62
463 0.54
464 0.45
465 0.43
466 0.36
467 0.27
468 0.17
469 0.13
470 0.11
471 0.1
472 0.09
473 0.07
474 0.06
475 0.06
476 0.06
477 0.08
478 0.07
479 0.08
480 0.1
481 0.15
482 0.16
483 0.17
484 0.19
485 0.26
486 0.27
487 0.32
488 0.32
489 0.29
490 0.32
491 0.37
492 0.36
493 0.3
494 0.32
495 0.29
496 0.29
497 0.3
498 0.3
499 0.3
500 0.33
501 0.35
502 0.37
503 0.38
504 0.37
505 0.42
506 0.47
507 0.44
508 0.43
509 0.44
510 0.46
511 0.44
512 0.45
513 0.39
514 0.4
515 0.41
516 0.43
517 0.41
518 0.35
519 0.34
520 0.39
521 0.43
522 0.43
523 0.49
524 0.53
525 0.59
526 0.64
527 0.66
528 0.67
529 0.72
530 0.73
531 0.72
532 0.71
533 0.67
534 0.62
535 0.59
536 0.52
537 0.41