Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BJA4

Protein Details
Accession A0A0P1BJA4   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-60AAATKTAKKKKWSKGKVKDKAQNMHydrophilic
NLS Segment(s)
PositionSequence
27-55KMPPKKSAILAAATKTAKKKKWSKGKVKD
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPAYVSPTDLLDHQHSLSIHVSSRLPKMPPKKSAILAAATKTAKKKKWSKGKVKDKAQNMVVLDRPTYDKILKEVPTFKMISQSTLIDRMKINGSLARVAIQHLVREGQIKKVIHHRGQLVYTRVGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.22
4 0.23
5 0.2
6 0.18
7 0.18
8 0.2
9 0.2
10 0.24
11 0.26
12 0.27
13 0.33
14 0.41
15 0.47
16 0.52
17 0.55
18 0.55
19 0.53
20 0.55
21 0.51
22 0.45
23 0.39
24 0.33
25 0.33
26 0.29
27 0.29
28 0.3
29 0.34
30 0.35
31 0.42
32 0.5
33 0.55
34 0.66
35 0.73
36 0.78
37 0.82
38 0.89
39 0.89
40 0.89
41 0.86
42 0.8
43 0.75
44 0.65
45 0.57
46 0.47
47 0.39
48 0.32
49 0.25
50 0.2
51 0.15
52 0.16
53 0.13
54 0.14
55 0.13
56 0.12
57 0.13
58 0.18
59 0.19
60 0.2
61 0.23
62 0.23
63 0.25
64 0.26
65 0.24
66 0.26
67 0.25
68 0.24
69 0.22
70 0.21
71 0.19
72 0.25
73 0.25
74 0.19
75 0.19
76 0.2
77 0.2
78 0.19
79 0.2
80 0.15
81 0.16
82 0.16
83 0.16
84 0.15
85 0.13
86 0.14
87 0.17
88 0.16
89 0.15
90 0.15
91 0.16
92 0.15
93 0.21
94 0.21
95 0.22
96 0.28
97 0.28
98 0.31
99 0.4
100 0.48
101 0.47
102 0.52
103 0.51
104 0.49
105 0.53
106 0.56
107 0.5
108 0.45