Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BME8

Protein Details
Accession A0A0P1BME8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
47-72ALELRHRWTKHPKLNQQRSARIHNKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MYVKMLKRAFYGLRISWMLDRIQSIVNSLRRWRLDDSLRDRNQFDSALELRHRWTKHPKLNQQRSARIHNKGST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.27
4 0.27
5 0.23
6 0.18
7 0.18
8 0.14
9 0.15
10 0.14
11 0.14
12 0.18
13 0.21
14 0.23
15 0.24
16 0.28
17 0.27
18 0.3
19 0.3
20 0.3
21 0.32
22 0.38
23 0.43
24 0.48
25 0.5
26 0.49
27 0.47
28 0.42
29 0.38
30 0.31
31 0.23
32 0.18
33 0.17
34 0.18
35 0.19
36 0.18
37 0.19
38 0.25
39 0.26
40 0.27
41 0.37
42 0.44
43 0.53
44 0.62
45 0.71
46 0.76
47 0.86
48 0.89
49 0.87
50 0.87
51 0.83
52 0.83
53 0.8
54 0.77