Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BCI1

Protein Details
Accession A0A0P1BCI1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MRSCNTSPCRRSPRRPPTPTLPHPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRSCNTSPCRRSPRRPPTPTLPHPLICAFSLRLRQIQPSFHIMSVHHSASQLELTDHSRMHIFLNARMPARRVTLRHSSLIFDAVGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.84
4 0.83
5 0.84
6 0.81
7 0.78
8 0.71
9 0.6
10 0.56
11 0.5
12 0.41
13 0.31
14 0.26
15 0.19
16 0.18
17 0.21
18 0.2
19 0.22
20 0.21
21 0.26
22 0.26
23 0.27
24 0.27
25 0.27
26 0.27
27 0.24
28 0.24
29 0.19
30 0.21
31 0.22
32 0.2
33 0.15
34 0.14
35 0.13
36 0.13
37 0.13
38 0.1
39 0.07
40 0.08
41 0.1
42 0.11
43 0.11
44 0.11
45 0.11
46 0.12
47 0.12
48 0.15
49 0.14
50 0.17
51 0.23
52 0.26
53 0.27
54 0.28
55 0.29
56 0.27
57 0.32
58 0.33
59 0.29
60 0.32
61 0.4
62 0.43
63 0.46
64 0.44
65 0.41
66 0.37
67 0.37