Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JP43

Protein Details
Accession G3JP43    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
210-230HLSLNRKGHHRHKTHRLSARHBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 8, mito 6, extr 5, cyto 3.5
Family & Domain DBs
KEGG cmt:CCM_07905  -  
Amino Acid Sequences MEAYGGGVWAGQGRSTNFFFHGRAWALAGNGSLMTKTHHIVSASAPPLQLPPVAAAALIDQLAQRGRLGRVAPGTPIEAAERPRNIAPVSQSYVVENARHEKDDTQIVLSAQSKRLRGEPGCAALQHAQTDRYRIRCYKHVVGPKGSQKYGHGLTPADHCYQLPMQRLQDARNTTTQDTSHHRFFPTCEAKDASFRQSAPYIRTGHTLPHLSLNRKGHHRHKTHRLSARHHGPIDLPGSLGLGSSTLTRQRRHRLTCWGQPGPTGVDNPAIQCSAIPGSERTSDFPWPLSPPQDFLPAPPTEKKEASIPPSRSNEAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.23
4 0.23
5 0.26
6 0.26
7 0.25
8 0.29
9 0.26
10 0.25
11 0.25
12 0.23
13 0.21
14 0.2
15 0.18
16 0.13
17 0.11
18 0.1
19 0.09
20 0.08
21 0.1
22 0.11
23 0.12
24 0.13
25 0.16
26 0.17
27 0.18
28 0.21
29 0.26
30 0.26
31 0.26
32 0.24
33 0.22
34 0.22
35 0.22
36 0.19
37 0.12
38 0.11
39 0.11
40 0.11
41 0.1
42 0.09
43 0.08
44 0.09
45 0.08
46 0.07
47 0.05
48 0.07
49 0.08
50 0.09
51 0.09
52 0.11
53 0.12
54 0.16
55 0.16
56 0.18
57 0.21
58 0.22
59 0.22
60 0.2
61 0.21
62 0.17
63 0.17
64 0.16
65 0.15
66 0.18
67 0.21
68 0.21
69 0.23
70 0.23
71 0.25
72 0.23
73 0.23
74 0.23
75 0.23
76 0.26
77 0.25
78 0.25
79 0.23
80 0.26
81 0.24
82 0.22
83 0.18
84 0.2
85 0.2
86 0.21
87 0.22
88 0.2
89 0.21
90 0.24
91 0.23
92 0.18
93 0.18
94 0.17
95 0.18
96 0.2
97 0.2
98 0.21
99 0.24
100 0.24
101 0.24
102 0.27
103 0.3
104 0.28
105 0.3
106 0.27
107 0.27
108 0.27
109 0.26
110 0.25
111 0.22
112 0.22
113 0.19
114 0.17
115 0.17
116 0.16
117 0.22
118 0.23
119 0.24
120 0.28
121 0.29
122 0.32
123 0.35
124 0.42
125 0.44
126 0.47
127 0.51
128 0.5
129 0.51
130 0.54
131 0.55
132 0.52
133 0.45
134 0.39
135 0.32
136 0.33
137 0.3
138 0.25
139 0.19
140 0.15
141 0.16
142 0.19
143 0.2
144 0.16
145 0.15
146 0.14
147 0.14
148 0.16
149 0.19
150 0.19
151 0.18
152 0.18
153 0.22
154 0.23
155 0.23
156 0.26
157 0.25
158 0.24
159 0.25
160 0.27
161 0.24
162 0.25
163 0.24
164 0.22
165 0.26
166 0.29
167 0.29
168 0.28
169 0.28
170 0.26
171 0.27
172 0.34
173 0.35
174 0.31
175 0.3
176 0.31
177 0.31
178 0.36
179 0.37
180 0.31
181 0.25
182 0.24
183 0.24
184 0.26
185 0.27
186 0.24
187 0.27
188 0.26
189 0.24
190 0.27
191 0.25
192 0.23
193 0.25
194 0.25
195 0.2
196 0.25
197 0.29
198 0.3
199 0.36
200 0.39
201 0.4
202 0.45
203 0.52
204 0.53
205 0.58
206 0.65
207 0.67
208 0.73
209 0.78
210 0.8
211 0.82
212 0.8
213 0.77
214 0.78
215 0.78
216 0.73
217 0.63
218 0.55
219 0.47
220 0.44
221 0.39
222 0.29
223 0.2
224 0.13
225 0.13
226 0.12
227 0.11
228 0.06
229 0.04
230 0.05
231 0.05
232 0.08
233 0.14
234 0.19
235 0.24
236 0.32
237 0.42
238 0.51
239 0.58
240 0.61
241 0.65
242 0.69
243 0.73
244 0.75
245 0.69
246 0.6
247 0.54
248 0.51
249 0.44
250 0.38
251 0.3
252 0.22
253 0.22
254 0.22
255 0.22
256 0.21
257 0.17
258 0.15
259 0.13
260 0.15
261 0.12
262 0.12
263 0.13
264 0.13
265 0.16
266 0.2
267 0.22
268 0.23
269 0.25
270 0.28
271 0.27
272 0.28
273 0.27
274 0.28
275 0.31
276 0.32
277 0.31
278 0.3
279 0.31
280 0.36
281 0.33
282 0.31
283 0.33
284 0.3
285 0.33
286 0.37
287 0.4
288 0.39
289 0.4
290 0.4
291 0.4
292 0.45
293 0.48
294 0.51
295 0.51
296 0.54
297 0.59
298 0.61