Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1BLW3

Protein Details
Accession A0A0P1BLW3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
239-258IARTSSRKAFERKKRSMLAHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 10.5, mito 9, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000631  CARKD  
IPR029056  Ribokinase-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0047453  F:ATP-dependent NAD(P)H-hydrate dehydratase activity  
GO:0016301  F:kinase activity  
GO:0046496  P:nicotinamide nucleotide metabolic process  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01256  Carb_kinase  
PROSITE View protein in PROSITE  
PS51383  YJEF_C_3  
CDD cd01171  YXKO-related  
Amino Acid Sequences MSSHSSRPAMDPCALSDLRNLIPPLTSEAHKGQAGRVGIVGGSADYSGAPFFAAMTSMRLGCDMSFNICSPDAGHVIKTYSPDLIVMTLLRQEKTDEQLKDALRPILGRLHALVVGPGLGRDKHMQTAGKIAIQLAKSQQLPIVVDADGLWLLSNEPNLLKGYNNAILTPNVGKVDRISNGKQVLHVDAPGSLKRCGGQGDILSGSLGTFIAWAQVSPYKDRIEAERRPLLAAFGAALIARTSSRKAFERKKRSMLAHDAIDEVGNAYEEYFGDLISASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.27
4 0.27
5 0.24
6 0.28
7 0.26
8 0.2
9 0.2
10 0.21
11 0.23
12 0.22
13 0.22
14 0.22
15 0.25
16 0.28
17 0.29
18 0.29
19 0.25
20 0.27
21 0.27
22 0.23
23 0.2
24 0.16
25 0.14
26 0.13
27 0.12
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.08
43 0.09
44 0.09
45 0.09
46 0.1
47 0.1
48 0.09
49 0.11
50 0.1
51 0.12
52 0.13
53 0.13
54 0.15
55 0.15
56 0.15
57 0.13
58 0.15
59 0.15
60 0.14
61 0.14
62 0.13
63 0.14
64 0.15
65 0.16
66 0.15
67 0.12
68 0.12
69 0.11
70 0.11
71 0.1
72 0.09
73 0.07
74 0.07
75 0.1
76 0.12
77 0.12
78 0.12
79 0.14
80 0.15
81 0.2
82 0.27
83 0.23
84 0.24
85 0.29
86 0.29
87 0.3
88 0.3
89 0.26
90 0.2
91 0.19
92 0.18
93 0.17
94 0.17
95 0.14
96 0.13
97 0.12
98 0.12
99 0.12
100 0.11
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.07
108 0.09
109 0.1
110 0.12
111 0.15
112 0.15
113 0.15
114 0.19
115 0.19
116 0.17
117 0.16
118 0.15
119 0.15
120 0.14
121 0.15
122 0.11
123 0.14
124 0.13
125 0.13
126 0.14
127 0.11
128 0.12
129 0.11
130 0.11
131 0.08
132 0.08
133 0.07
134 0.07
135 0.06
136 0.05
137 0.04
138 0.03
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.06
145 0.07
146 0.07
147 0.07
148 0.08
149 0.11
150 0.14
151 0.14
152 0.13
153 0.14
154 0.14
155 0.15
156 0.15
157 0.13
158 0.11
159 0.11
160 0.1
161 0.1
162 0.14
163 0.15
164 0.19
165 0.2
166 0.24
167 0.27
168 0.27
169 0.28
170 0.26
171 0.25
172 0.21
173 0.2
174 0.15
175 0.14
176 0.16
177 0.16
178 0.17
179 0.15
180 0.15
181 0.15
182 0.16
183 0.15
184 0.14
185 0.15
186 0.13
187 0.16
188 0.16
189 0.15
190 0.14
191 0.12
192 0.1
193 0.08
194 0.07
195 0.04
196 0.03
197 0.03
198 0.05
199 0.05
200 0.05
201 0.07
202 0.11
203 0.13
204 0.16
205 0.2
206 0.2
207 0.22
208 0.23
209 0.28
210 0.33
211 0.37
212 0.42
213 0.44
214 0.44
215 0.44
216 0.42
217 0.36
218 0.28
219 0.22
220 0.15
221 0.09
222 0.08
223 0.07
224 0.07
225 0.06
226 0.06
227 0.07
228 0.08
229 0.11
230 0.14
231 0.19
232 0.25
233 0.35
234 0.45
235 0.55
236 0.65
237 0.71
238 0.77
239 0.8
240 0.8
241 0.78
242 0.77
243 0.72
244 0.65
245 0.57
246 0.49
247 0.41
248 0.35
249 0.27
250 0.18
251 0.12
252 0.09
253 0.08
254 0.07
255 0.07
256 0.07
257 0.1
258 0.09
259 0.08
260 0.08