Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3J3T1

Protein Details
Accession G3J3T1    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-130AERETKKNAKDDRKSLRRQSEHBasic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 13.333, nucl 10, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cmt:CCM_01213  -  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSSQVSKAARRVTHELHGVVVSAGLMQKTVKVRVAGQKWNKIVNKFYADPKHYLVHDPNSSLRTGDVVAIAPGWPTSRHKRHVVKQIIAPFGEPIESRPVVPSLNEIIAERETKKNAKDDRKSLRRQSEHEQRLSQKKVAADEREVKRTAWEQLMVKFGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.39
4 0.36
5 0.3
6 0.23
7 0.18
8 0.11
9 0.07
10 0.08
11 0.06
12 0.06
13 0.06
14 0.1
15 0.13
16 0.16
17 0.18
18 0.19
19 0.23
20 0.32
21 0.38
22 0.44
23 0.49
24 0.54
25 0.54
26 0.61
27 0.61
28 0.55
29 0.53
30 0.49
31 0.47
32 0.42
33 0.46
34 0.46
35 0.45
36 0.45
37 0.44
38 0.41
39 0.35
40 0.37
41 0.33
42 0.31
43 0.29
44 0.29
45 0.28
46 0.26
47 0.26
48 0.22
49 0.18
50 0.12
51 0.11
52 0.1
53 0.08
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.1
63 0.19
64 0.25
65 0.3
66 0.38
67 0.45
68 0.52
69 0.61
70 0.64
71 0.58
72 0.57
73 0.57
74 0.51
75 0.44
76 0.36
77 0.26
78 0.19
79 0.17
80 0.12
81 0.08
82 0.12
83 0.12
84 0.12
85 0.13
86 0.13
87 0.13
88 0.13
89 0.14
90 0.11
91 0.11
92 0.12
93 0.11
94 0.12
95 0.13
96 0.15
97 0.15
98 0.16
99 0.19
100 0.22
101 0.25
102 0.32
103 0.39
104 0.48
105 0.54
106 0.6
107 0.68
108 0.74
109 0.8
110 0.81
111 0.83
112 0.78
113 0.76
114 0.76
115 0.76
116 0.74
117 0.72
118 0.69
119 0.66
120 0.7
121 0.69
122 0.62
123 0.54
124 0.49
125 0.5
126 0.51
127 0.48
128 0.46
129 0.51
130 0.54
131 0.56
132 0.54
133 0.47
134 0.45
135 0.43
136 0.41
137 0.36
138 0.36
139 0.34
140 0.36