Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BS93

Protein Details
Accession A0A0P1BS93   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
82-102NPPPTFSLSPPPQKKKNENLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10, nucl 7
Family & Domain DBs
Amino Acid Sequences MTLRAPHRHACPPPSLSTLYVRVCTWPETQCMPRGACFTRLARESHVEPAQDTKKKSSLNPSLFGQRKLLPLLAISDYSFTNPPPTFSLSPPPQKKKNENLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.4
4 0.38
5 0.4
6 0.35
7 0.32
8 0.28
9 0.26
10 0.25
11 0.26
12 0.25
13 0.21
14 0.22
15 0.25
16 0.27
17 0.3
18 0.32
19 0.3
20 0.28
21 0.31
22 0.29
23 0.28
24 0.29
25 0.26
26 0.27
27 0.28
28 0.27
29 0.25
30 0.27
31 0.25
32 0.26
33 0.26
34 0.22
35 0.2
36 0.24
37 0.28
38 0.29
39 0.28
40 0.26
41 0.29
42 0.3
43 0.32
44 0.36
45 0.4
46 0.4
47 0.42
48 0.41
49 0.46
50 0.47
51 0.46
52 0.39
53 0.32
54 0.3
55 0.28
56 0.27
57 0.18
58 0.16
59 0.17
60 0.15
61 0.13
62 0.11
63 0.11
64 0.11
65 0.13
66 0.13
67 0.11
68 0.16
69 0.16
70 0.18
71 0.2
72 0.26
73 0.27
74 0.29
75 0.38
76 0.4
77 0.5
78 0.58
79 0.64
80 0.66
81 0.74
82 0.8