Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0N7LA02

Protein Details
Accession A0A0N7LA02    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-44QTPKVEKQEKPKQPKGRANKRNLYNRRFHydrophilic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVEKQEKPKQPKGRANKRN
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRANKRNLYNRRFVNVVVGPGGKRRANAQGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.7
9 0.69
10 0.71
11 0.74
12 0.75
13 0.78
14 0.78
15 0.79
16 0.78
17 0.82
18 0.83
19 0.83
20 0.83
21 0.83
22 0.82
23 0.81
24 0.82
25 0.82
26 0.77
27 0.74
28 0.68
29 0.62
30 0.55
31 0.46
32 0.43
33 0.35
34 0.31
35 0.25
36 0.24
37 0.21
38 0.24
39 0.3
40 0.24
41 0.23
42 0.25