Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1BIH2

Protein Details
Accession A0A0P1BIH2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTTWHFKMPSRLSKNRKLRGHVHydrophilic
NLS Segment(s)
PositionSequence
11-40RLSKNRKLRGHVSGGHGRVGKHRKHPGGRG
Subcellular Location(s) mito 14, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR030878  Ribosomal_L15  
IPR001196  Ribosomal_L15_CS  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00828  Ribosomal_L27A  
PROSITE View protein in PROSITE  
PS00475  RIBOSOMAL_L15  
Amino Acid Sequences MTTWHFKMPSRLSKNRKLRGHVSGGHGRVGKHRKHPGGRGLAGGQHHHRTNFDKYHPGYFGKVGMRHFHLTRNSYYRPVVNLDKLWTLVPAEQRKGLTSSSTEVPVIDTLAAGYGKVLGKGRLPQLPFIVKARWVSELAEKKIKEAGGVVKLIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.83
4 0.79
5 0.77
6 0.74
7 0.74
8 0.68
9 0.65
10 0.63
11 0.57
12 0.54
13 0.49
14 0.42
15 0.43
16 0.46
17 0.45
18 0.46
19 0.54
20 0.59
21 0.64
22 0.7
23 0.7
24 0.7
25 0.65
26 0.58
27 0.5
28 0.44
29 0.39
30 0.35
31 0.3
32 0.27
33 0.27
34 0.25
35 0.27
36 0.29
37 0.34
38 0.36
39 0.35
40 0.37
41 0.37
42 0.41
43 0.4
44 0.37
45 0.32
46 0.27
47 0.28
48 0.23
49 0.24
50 0.21
51 0.22
52 0.24
53 0.25
54 0.25
55 0.27
56 0.28
57 0.28
58 0.3
59 0.33
60 0.31
61 0.31
62 0.31
63 0.27
64 0.24
65 0.25
66 0.24
67 0.2
68 0.19
69 0.19
70 0.18
71 0.18
72 0.16
73 0.12
74 0.11
75 0.11
76 0.17
77 0.19
78 0.19
79 0.21
80 0.21
81 0.22
82 0.23
83 0.21
84 0.16
85 0.14
86 0.15
87 0.15
88 0.16
89 0.15
90 0.13
91 0.14
92 0.12
93 0.11
94 0.08
95 0.06
96 0.05
97 0.06
98 0.06
99 0.05
100 0.05
101 0.07
102 0.08
103 0.1
104 0.11
105 0.11
106 0.14
107 0.19
108 0.23
109 0.25
110 0.26
111 0.27
112 0.31
113 0.34
114 0.34
115 0.32
116 0.31
117 0.29
118 0.3
119 0.29
120 0.27
121 0.24
122 0.24
123 0.3
124 0.36
125 0.39
126 0.44
127 0.42
128 0.41
129 0.44
130 0.42
131 0.33
132 0.29
133 0.3
134 0.27