Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3J661

Protein Details
Accession G3J661    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-59EGAISVKKKSEKNKRQQWECWEMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 12, nucl 7.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011057  Mss4-like_sf  
IPR011323  Mss4/transl-control_tumour  
IPR034737  TCTP  
IPR018103  Translation_control_tumour_CS  
IPR018105  Translational_control_tumour_p  
KEGG cmt:CCM_01619  -  
Pfam View protein in Pfam  
PF00838  TCTP  
PROSITE View protein in PROSITE  
PS01003  TCTP_2  
PS51797  TCTP_3  
Amino Acid Sequences MLIYKDILTDDEIVADSYDVKLVDDIVYEVDCAMITEGAISVKKKSEKNKRQQWECWEMLRGTINSISDNTGANASAEEVEESVEDADVKVNNIVNSFRLQSTQFDKKGYLVYLKGYMKAVKAKLLENGAPAEEITAFEKGASVYVKEKLLPNFKDFEFYTGESMNPDGLIVLLNYREDGVTPYIIVWKHGLKEMKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.07
5 0.09
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.08
15 0.08
16 0.07
17 0.06
18 0.06
19 0.06
20 0.06
21 0.05
22 0.04
23 0.05
24 0.05
25 0.06
26 0.08
27 0.09
28 0.1
29 0.16
30 0.22
31 0.27
32 0.37
33 0.48
34 0.57
35 0.67
36 0.76
37 0.81
38 0.83
39 0.85
40 0.83
41 0.8
42 0.72
43 0.63
44 0.56
45 0.46
46 0.39
47 0.36
48 0.27
49 0.2
50 0.19
51 0.16
52 0.14
53 0.14
54 0.14
55 0.11
56 0.11
57 0.1
58 0.09
59 0.09
60 0.08
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.04
67 0.05
68 0.04
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07
80 0.08
81 0.09
82 0.08
83 0.1
84 0.1
85 0.09
86 0.1
87 0.1
88 0.12
89 0.18
90 0.24
91 0.24
92 0.24
93 0.24
94 0.24
95 0.25
96 0.23
97 0.19
98 0.13
99 0.13
100 0.18
101 0.18
102 0.19
103 0.18
104 0.18
105 0.18
106 0.22
107 0.22
108 0.19
109 0.21
110 0.21
111 0.22
112 0.24
113 0.23
114 0.19
115 0.19
116 0.16
117 0.14
118 0.13
119 0.1
120 0.07
121 0.07
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.09
129 0.09
130 0.09
131 0.1
132 0.13
133 0.14
134 0.16
135 0.2
136 0.24
137 0.32
138 0.34
139 0.34
140 0.36
141 0.35
142 0.38
143 0.34
144 0.31
145 0.26
146 0.25
147 0.24
148 0.21
149 0.21
150 0.17
151 0.17
152 0.15
153 0.1
154 0.09
155 0.06
156 0.06
157 0.06
158 0.05
159 0.06
160 0.07
161 0.07
162 0.07
163 0.08
164 0.08
165 0.08
166 0.11
167 0.12
168 0.12
169 0.12
170 0.12
171 0.16
172 0.16
173 0.18
174 0.18
175 0.2
176 0.21
177 0.28