Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1BL33

Protein Details
Accession A0A0P1BL33    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-70HAHHAAKRRAKLRRKPLKTWALIHBasic
NLS Segment(s)
PositionSequence
51-63AAKRRAKLRRKPL
Subcellular Location(s) nucl 7, cysk 6, mito_nucl 6, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MWDFMAVFHLETADLLLVHSLYEGHDGCALRVTQSQRWSVTIGRDLHAHHAAKRRAKLRRKPLKTWALIHAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.04
8 0.04
9 0.07
10 0.08
11 0.08
12 0.11
13 0.11
14 0.11
15 0.14
16 0.13
17 0.11
18 0.15
19 0.17
20 0.18
21 0.21
22 0.24
23 0.22
24 0.23
25 0.24
26 0.22
27 0.21
28 0.23
29 0.21
30 0.2
31 0.21
32 0.21
33 0.24
34 0.28
35 0.27
36 0.25
37 0.33
38 0.39
39 0.44
40 0.5
41 0.53
42 0.58
43 0.67
44 0.73
45 0.75
46 0.8
47 0.82
48 0.83
49 0.85
50 0.86
51 0.82
52 0.77