Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BJJ6

Protein Details
Accession A0A0P1BJJ6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-47ASTSQLPKEQTRKRKHSEGSAKEERKKERRSDKSSSNTSHRHydrophilic
NLS Segment(s)
PositionSequence
18-37RKRKHSEGSAKEERKKERRS
523-531KPRRGPAKR
Subcellular Location(s) nucl 13, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009668  RNA_pol-assoc_fac_A49-like  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF06870  RNA_pol_I_A49  
Amino Acid Sequences MALPDMASTSQLPKEQTRKRKHSEGSAKEERKKERRSDKSSSNTSHRSQAVPDEDIRKAGYLNNGECVPTDHAVVNVGKDASRKLGPVLAMFSDYEPPPSTSFAMYAAAAPDDKSPSGTTLSNRLMLTGETDTMSYVGTNWISSAAAPENSDEDRLSARGYSGEFLVGIYDPATSTVTLRVAPAFVVRRRIKALAEQSLAISSVLDGDGAQDYAARMLARRDLGEAFGNRKTKLKARNDDRMKVNTENMTDIMTTMREGIETSSKHMDSADAVEAAAKAAQAIPPHNEHAENPREAYAIGDLVPSSILKAIDITNLLLASSPEAVKQGLPVGGPAKSKWLVGKAWEAIQQVNHGSSVAAPVGILKTSTGGSVKDDGKLRLTLCLYAAMLWKLHDEKMNVGRPNDRQKLLEKLKVDENKHGRMIFAHLMDTFAEKMRSTHRYNVTPFTETKCLAYFAAITLHINNFSVDVKELAKDMGIESRRLGDVYKSLGCTPSSASVRSSNGEKAIKESRLVLKCPFTIPKPRRGPAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.6
4 0.67
5 0.73
6 0.78
7 0.85
8 0.83
9 0.84
10 0.85
11 0.84
12 0.83
13 0.84
14 0.84
15 0.82
16 0.83
17 0.82
18 0.81
19 0.81
20 0.81
21 0.81
22 0.83
23 0.84
24 0.85
25 0.85
26 0.85
27 0.85
28 0.82
29 0.8
30 0.76
31 0.7
32 0.69
33 0.62
34 0.54
35 0.47
36 0.47
37 0.43
38 0.4
39 0.42
40 0.39
41 0.37
42 0.36
43 0.35
44 0.27
45 0.23
46 0.22
47 0.25
48 0.26
49 0.27
50 0.29
51 0.28
52 0.28
53 0.28
54 0.28
55 0.25
56 0.19
57 0.2
58 0.17
59 0.16
60 0.2
61 0.2
62 0.17
63 0.15
64 0.15
65 0.14
66 0.15
67 0.16
68 0.17
69 0.18
70 0.18
71 0.17
72 0.2
73 0.2
74 0.2
75 0.21
76 0.17
77 0.17
78 0.17
79 0.17
80 0.17
81 0.16
82 0.18
83 0.17
84 0.18
85 0.18
86 0.2
87 0.2
88 0.17
89 0.18
90 0.16
91 0.15
92 0.13
93 0.13
94 0.11
95 0.1
96 0.1
97 0.1
98 0.11
99 0.12
100 0.12
101 0.13
102 0.13
103 0.14
104 0.16
105 0.18
106 0.18
107 0.24
108 0.26
109 0.28
110 0.27
111 0.26
112 0.24
113 0.22
114 0.23
115 0.16
116 0.15
117 0.11
118 0.11
119 0.1
120 0.1
121 0.1
122 0.07
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.09
132 0.09
133 0.1
134 0.1
135 0.11
136 0.13
137 0.13
138 0.14
139 0.12
140 0.11
141 0.12
142 0.12
143 0.12
144 0.09
145 0.09
146 0.1
147 0.1
148 0.1
149 0.09
150 0.09
151 0.08
152 0.08
153 0.08
154 0.06
155 0.06
156 0.05
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.08
164 0.09
165 0.09
166 0.1
167 0.09
168 0.09
169 0.09
170 0.12
171 0.16
172 0.17
173 0.26
174 0.27
175 0.3
176 0.33
177 0.34
178 0.31
179 0.33
180 0.37
181 0.34
182 0.33
183 0.31
184 0.28
185 0.27
186 0.26
187 0.19
188 0.12
189 0.06
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.06
202 0.05
203 0.05
204 0.06
205 0.09
206 0.1
207 0.1
208 0.11
209 0.11
210 0.12
211 0.15
212 0.16
213 0.16
214 0.2
215 0.22
216 0.21
217 0.24
218 0.26
219 0.29
220 0.37
221 0.43
222 0.48
223 0.53
224 0.63
225 0.66
226 0.7
227 0.68
228 0.63
229 0.57
230 0.49
231 0.45
232 0.37
233 0.31
234 0.25
235 0.21
236 0.18
237 0.13
238 0.12
239 0.09
240 0.07
241 0.06
242 0.06
243 0.05
244 0.04
245 0.05
246 0.06
247 0.09
248 0.1
249 0.12
250 0.15
251 0.15
252 0.15
253 0.15
254 0.14
255 0.1
256 0.12
257 0.1
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.06
264 0.04
265 0.03
266 0.04
267 0.05
268 0.06
269 0.07
270 0.09
271 0.11
272 0.13
273 0.14
274 0.14
275 0.14
276 0.19
277 0.22
278 0.21
279 0.2
280 0.19
281 0.18
282 0.18
283 0.17
284 0.11
285 0.07
286 0.07
287 0.06
288 0.05
289 0.05
290 0.05
291 0.04
292 0.04
293 0.05
294 0.05
295 0.05
296 0.06
297 0.06
298 0.07
299 0.08
300 0.08
301 0.07
302 0.07
303 0.07
304 0.06
305 0.05
306 0.05
307 0.06
308 0.06
309 0.06
310 0.07
311 0.07
312 0.07
313 0.07
314 0.08
315 0.08
316 0.08
317 0.09
318 0.1
319 0.12
320 0.13
321 0.12
322 0.15
323 0.15
324 0.16
325 0.17
326 0.19
327 0.17
328 0.19
329 0.24
330 0.2
331 0.22
332 0.25
333 0.24
334 0.21
335 0.21
336 0.2
337 0.16
338 0.15
339 0.13
340 0.1
341 0.09
342 0.08
343 0.08
344 0.07
345 0.06
346 0.05
347 0.06
348 0.06
349 0.06
350 0.06
351 0.05
352 0.06
353 0.06
354 0.07
355 0.08
356 0.08
357 0.1
358 0.15
359 0.16
360 0.19
361 0.22
362 0.22
363 0.24
364 0.26
365 0.24
366 0.23
367 0.23
368 0.2
369 0.18
370 0.18
371 0.16
372 0.14
373 0.16
374 0.13
375 0.12
376 0.12
377 0.14
378 0.14
379 0.16
380 0.18
381 0.17
382 0.22
383 0.3
384 0.37
385 0.37
386 0.38
387 0.42
388 0.45
389 0.54
390 0.55
391 0.49
392 0.44
393 0.45
394 0.54
395 0.55
396 0.53
397 0.45
398 0.42
399 0.49
400 0.53
401 0.53
402 0.52
403 0.51
404 0.51
405 0.53
406 0.49
407 0.41
408 0.35
409 0.37
410 0.32
411 0.26
412 0.22
413 0.18
414 0.19
415 0.19
416 0.19
417 0.15
418 0.13
419 0.13
420 0.12
421 0.14
422 0.2
423 0.26
424 0.29
425 0.37
426 0.42
427 0.48
428 0.52
429 0.58
430 0.55
431 0.52
432 0.5
433 0.47
434 0.44
435 0.38
436 0.36
437 0.3
438 0.27
439 0.24
440 0.23
441 0.18
442 0.14
443 0.16
444 0.14
445 0.13
446 0.14
447 0.15
448 0.15
449 0.14
450 0.13
451 0.12
452 0.13
453 0.13
454 0.12
455 0.12
456 0.13
457 0.13
458 0.14
459 0.12
460 0.12
461 0.11
462 0.11
463 0.17
464 0.18
465 0.19
466 0.19
467 0.22
468 0.22
469 0.22
470 0.22
471 0.17
472 0.19
473 0.23
474 0.26
475 0.25
476 0.26
477 0.28
478 0.27
479 0.26
480 0.25
481 0.28
482 0.27
483 0.27
484 0.28
485 0.31
486 0.33
487 0.35
488 0.36
489 0.31
490 0.35
491 0.38
492 0.35
493 0.37
494 0.42
495 0.41
496 0.39
497 0.41
498 0.44
499 0.45
500 0.48
501 0.47
502 0.45
503 0.45
504 0.49
505 0.5
506 0.46
507 0.52
508 0.55
509 0.6
510 0.64
511 0.68