Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BQB4

Protein Details
Accession A0A0P1BQB4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
76-98LLARKEHQLQKRTRNRRLYQDILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6, nucl 5, plas 5, cyto 3, pero 2, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGPLSVLARNRRRAQQGESEPLLNGEASSQRYRDSLDTRGIVPPAGQASEDHASSAPTWQNEATAALSSDEATRILLARKEHQLQKRTRNRRLYQDILVVFGILPLGIALIVLGTMDLAHGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.64
4 0.64
5 0.6
6 0.54
7 0.46
8 0.41
9 0.35
10 0.25
11 0.17
12 0.1
13 0.11
14 0.14
15 0.16
16 0.16
17 0.16
18 0.17
19 0.19
20 0.22
21 0.23
22 0.22
23 0.25
24 0.26
25 0.26
26 0.28
27 0.26
28 0.21
29 0.17
30 0.15
31 0.12
32 0.1
33 0.09
34 0.07
35 0.12
36 0.13
37 0.13
38 0.12
39 0.11
40 0.11
41 0.11
42 0.13
43 0.11
44 0.09
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.1
64 0.12
65 0.15
66 0.2
67 0.26
68 0.33
69 0.39
70 0.46
71 0.51
72 0.6
73 0.68
74 0.73
75 0.77
76 0.8
77 0.78
78 0.8
79 0.81
80 0.76
81 0.69
82 0.66
83 0.57
84 0.49
85 0.43
86 0.32
87 0.23
88 0.18
89 0.13
90 0.06
91 0.05
92 0.03
93 0.03
94 0.03
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02