Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JBG0

Protein Details
Accession G3JBG0    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-130RILPRPKRSARSRNAQKQKRPRSRTLTAHydrophilic
NLS Segment(s)
PositionSequence
102-125RRILPRPKRSARSRNAQKQKRPRS
Subcellular Location(s) mito_nucl 12.332, nucl 11.5, mito 11.5, cyto_nucl 9.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cmt:CCM_02738  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSAQAQNKIAPNSPSRQNPSELEQSIAQALYDLETNTADLKAALRPLQIVSAREIEVGHGKKAVVIFVPVPSLQGFHRVQQRLTRELEKKFSDRHVLILASRRILPRPKRSARSRNAQKQKRPRSRTLTAVHDAILSDLCYPVEIVGKRIRTKEDGSKLLKVILDEKERAGVDYRVDTYAEVYRRLTGRNVTFEFPQTASEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.52
4 0.53
5 0.51
6 0.52
7 0.55
8 0.48
9 0.42
10 0.35
11 0.33
12 0.3
13 0.26
14 0.2
15 0.12
16 0.11
17 0.08
18 0.09
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.09
29 0.12
30 0.12
31 0.12
32 0.13
33 0.13
34 0.18
35 0.19
36 0.19
37 0.19
38 0.2
39 0.2
40 0.19
41 0.19
42 0.15
43 0.2
44 0.2
45 0.18
46 0.17
47 0.16
48 0.17
49 0.18
50 0.17
51 0.1
52 0.1
53 0.1
54 0.09
55 0.11
56 0.09
57 0.1
58 0.09
59 0.1
60 0.08
61 0.15
62 0.15
63 0.18
64 0.26
65 0.26
66 0.28
67 0.33
68 0.36
69 0.34
70 0.37
71 0.4
72 0.37
73 0.39
74 0.43
75 0.4
76 0.39
77 0.37
78 0.36
79 0.35
80 0.3
81 0.29
82 0.25
83 0.22
84 0.21
85 0.25
86 0.23
87 0.18
88 0.19
89 0.18
90 0.19
91 0.26
92 0.32
93 0.36
94 0.45
95 0.51
96 0.58
97 0.67
98 0.74
99 0.73
100 0.77
101 0.78
102 0.78
103 0.82
104 0.82
105 0.82
106 0.83
107 0.88
108 0.88
109 0.84
110 0.83
111 0.8
112 0.76
113 0.75
114 0.7
115 0.65
116 0.57
117 0.51
118 0.42
119 0.34
120 0.29
121 0.21
122 0.16
123 0.09
124 0.06
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.1
131 0.1
132 0.14
133 0.18
134 0.24
135 0.27
136 0.29
137 0.32
138 0.32
139 0.37
140 0.43
141 0.45
142 0.49
143 0.5
144 0.51
145 0.48
146 0.46
147 0.42
148 0.33
149 0.3
150 0.29
151 0.29
152 0.27
153 0.26
154 0.28
155 0.27
156 0.28
157 0.26
158 0.21
159 0.19
160 0.21
161 0.23
162 0.2
163 0.2
164 0.19
165 0.18
166 0.23
167 0.23
168 0.21
169 0.2
170 0.24
171 0.25
172 0.27
173 0.29
174 0.31
175 0.34
176 0.41
177 0.43
178 0.41
179 0.42
180 0.43
181 0.42
182 0.35