Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0N7LAD9

Protein Details
Accession A0A0N7LAD9    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-88VPAPPFSTTCKPKRKKTPCRSGFAKLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MMKIVTIRSPISERCCEKEARSSLCLDGPVHIGGAASGVGDDPHTESMLCQSARDYRIHTAVPAPPFSTTCKPKRKKTPCRSGFAKLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.44
4 0.43
5 0.47
6 0.47
7 0.44
8 0.42
9 0.38
10 0.36
11 0.35
12 0.34
13 0.25
14 0.19
15 0.16
16 0.14
17 0.12
18 0.11
19 0.09
20 0.07
21 0.07
22 0.05
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.11
36 0.11
37 0.1
38 0.11
39 0.15
40 0.18
41 0.19
42 0.2
43 0.18
44 0.21
45 0.21
46 0.21
47 0.2
48 0.22
49 0.23
50 0.22
51 0.2
52 0.19
53 0.2
54 0.25
55 0.3
56 0.34
57 0.41
58 0.5
59 0.58
60 0.67
61 0.77
62 0.83
63 0.86
64 0.89
65 0.91
66 0.89
67 0.9
68 0.86
69 0.84