Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1BMU5

Protein Details
Accession A0A0P1BMU5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKDESKKEAKRAKRQSEAAAHydrophilic
NLS Segment(s)
PositionSequence
11-13KRA
41-52KAKRKAEKKAAK
84-120HKKLSKRVLKTIKKASKSRGHVKRGVKEVVKGLRKGE
Subcellular Location(s) cyto 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MGKDESKKEAKRAKRQSEAAAAALGDVSMASAATDGAADDKAKRKAEKKAAKAAAAAVAGEDDEDDETAVNLDAISPIAHPLAHKKLSKRVLKTIKKASKSRGHVKRGVKEVVKGLRKGEKGLVIMAGDISPLDILSHIPVLCEETDNPYVFVQSKDELGAASSTKRPTSVVMICPTGLKGKKEVKEDYTEEYGNLHTEVKNLDERVVLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.79
4 0.78
5 0.71
6 0.61
7 0.5
8 0.4
9 0.3
10 0.25
11 0.17
12 0.08
13 0.05
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.05
25 0.06
26 0.1
27 0.17
28 0.23
29 0.27
30 0.33
31 0.38
32 0.47
33 0.57
34 0.64
35 0.65
36 0.69
37 0.69
38 0.65
39 0.6
40 0.51
41 0.43
42 0.33
43 0.25
44 0.15
45 0.1
46 0.08
47 0.07
48 0.06
49 0.03
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.1
69 0.16
70 0.21
71 0.24
72 0.26
73 0.35
74 0.43
75 0.5
76 0.48
77 0.53
78 0.58
79 0.63
80 0.67
81 0.7
82 0.68
83 0.69
84 0.69
85 0.67
86 0.65
87 0.64
88 0.67
89 0.66
90 0.64
91 0.65
92 0.67
93 0.65
94 0.61
95 0.59
96 0.5
97 0.42
98 0.42
99 0.42
100 0.4
101 0.35
102 0.32
103 0.33
104 0.33
105 0.32
106 0.29
107 0.25
108 0.21
109 0.21
110 0.19
111 0.12
112 0.12
113 0.1
114 0.08
115 0.05
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.06
125 0.06
126 0.06
127 0.06
128 0.08
129 0.08
130 0.09
131 0.09
132 0.13
133 0.16
134 0.16
135 0.17
136 0.16
137 0.17
138 0.16
139 0.17
140 0.14
141 0.12
142 0.12
143 0.11
144 0.11
145 0.1
146 0.1
147 0.1
148 0.09
149 0.1
150 0.14
151 0.15
152 0.16
153 0.16
154 0.16
155 0.17
156 0.23
157 0.26
158 0.28
159 0.3
160 0.31
161 0.3
162 0.3
163 0.29
164 0.3
165 0.28
166 0.25
167 0.29
168 0.36
169 0.42
170 0.48
171 0.52
172 0.49
173 0.53
174 0.54
175 0.52
176 0.49
177 0.44
178 0.37
179 0.33
180 0.29
181 0.23
182 0.21
183 0.17
184 0.12
185 0.14
186 0.15
187 0.18
188 0.22
189 0.22
190 0.22
191 0.21