Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BAW4

Protein Details
Accession A0A0P1BAW4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-75LGAGKRAKEQHKQKRQRATGRKEAAEBasic
NLS Segment(s)
PositionSequence
53-71GKRAKEQHKQKRQRATGRK
Subcellular Location(s) nucl 14, mito_nucl 12.166, cyto_nucl 9.666, mito 9, cyto_mito 7.166
Family & Domain DBs
Amino Acid Sequences MTAALGLGVRVEQSEPNGAASNVLRVRRSRSAKLLTSVWKTWMKTSSLVLGAGKRAKEQHKQKRQRATGRKEAAEQELNFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.16
5 0.15
6 0.16
7 0.15
8 0.19
9 0.19
10 0.21
11 0.21
12 0.22
13 0.28
14 0.35
15 0.41
16 0.39
17 0.43
18 0.47
19 0.47
20 0.49
21 0.47
22 0.43
23 0.41
24 0.37
25 0.35
26 0.32
27 0.3
28 0.29
29 0.28
30 0.24
31 0.21
32 0.22
33 0.2
34 0.17
35 0.17
36 0.16
37 0.14
38 0.16
39 0.17
40 0.17
41 0.16
42 0.21
43 0.26
44 0.35
45 0.45
46 0.53
47 0.61
48 0.72
49 0.78
50 0.84
51 0.88
52 0.89
53 0.89
54 0.87
55 0.86
56 0.84
57 0.78
58 0.72
59 0.66
60 0.62
61 0.59