Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1A4H7

Protein Details
Accession A0A0P1A4H7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-98TPYLRRSSLRRSKLRKSRNWQRRSPSDRLHydrophilic
NLS Segment(s)
PositionSequence
78-90LRRSKLRKSRNWQ
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPANNKDYLPSVMLYLAAGIVERKENACPEQAQTKFDFDILFFSASNRNNGCKEFNPNTVPKAKMLSNITPYLRRSSLRRSKLRKSRNWQRRSPSDRLLEANRLLKEEEHNVDDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.08
4 0.06
5 0.05
6 0.05
7 0.05
8 0.07
9 0.08
10 0.09
11 0.11
12 0.14
13 0.15
14 0.19
15 0.19
16 0.21
17 0.28
18 0.29
19 0.3
20 0.29
21 0.29
22 0.26
23 0.25
24 0.23
25 0.14
26 0.15
27 0.14
28 0.13
29 0.1
30 0.11
31 0.16
32 0.16
33 0.2
34 0.18
35 0.2
36 0.2
37 0.22
38 0.24
39 0.21
40 0.28
41 0.28
42 0.31
43 0.33
44 0.32
45 0.34
46 0.34
47 0.33
48 0.26
49 0.25
50 0.21
51 0.23
52 0.25
53 0.26
54 0.25
55 0.28
56 0.29
57 0.3
58 0.3
59 0.29
60 0.27
61 0.26
62 0.26
63 0.33
64 0.42
65 0.48
66 0.56
67 0.6
68 0.69
69 0.77
70 0.84
71 0.83
72 0.84
73 0.86
74 0.87
75 0.87
76 0.85
77 0.85
78 0.85
79 0.83
80 0.8
81 0.77
82 0.72
83 0.67
84 0.64
85 0.6
86 0.54
87 0.51
88 0.5
89 0.43
90 0.38
91 0.36
92 0.32
93 0.31
94 0.33
95 0.32
96 0.28
97 0.29