Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BDN3

Protein Details
Accession A0A0P1BDN3   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-56KALQRAFKPVQKRKRNNKPLVPEKNPHydrophilic
NLS Segment(s)
PositionSequence
40-48VQKRKRNNK
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 6.5, mito 3
Family & Domain DBs
Amino Acid Sequences MNTEHPSLATHVKEIMKNANSYKPEIVAIAKALQRAFKPVQKRKRNNKPLVPEKNPLTPEKPPLLPEAFAWLGKQALVKALVHLKSLRFWRRAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.31
4 0.33
5 0.36
6 0.38
7 0.36
8 0.38
9 0.36
10 0.29
11 0.26
12 0.24
13 0.22
14 0.15
15 0.14
16 0.15
17 0.15
18 0.16
19 0.16
20 0.17
21 0.16
22 0.21
23 0.23
24 0.23
25 0.33
26 0.4
27 0.51
28 0.59
29 0.69
30 0.75
31 0.83
32 0.89
33 0.88
34 0.86
35 0.85
36 0.85
37 0.84
38 0.78
39 0.72
40 0.64
41 0.61
42 0.56
43 0.49
44 0.42
45 0.36
46 0.35
47 0.34
48 0.33
49 0.28
50 0.3
51 0.29
52 0.25
53 0.23
54 0.24
55 0.21
56 0.2
57 0.19
58 0.15
59 0.14
60 0.14
61 0.14
62 0.09
63 0.1
64 0.12
65 0.12
66 0.15
67 0.21
68 0.22
69 0.23
70 0.26
71 0.24
72 0.29
73 0.38
74 0.43