Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BRR1

Protein Details
Accession A0A0P1BRR1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-27VGDRWSIQRRQRSQRAWFSCCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRNLRFVGDRWSIQRRQRSQRAWFSCCSIITNGIGQKLLSHCTLERLASNTAGPKVQGAPNTANPGILDLNMAIKYRKRILGAFVLFRAWRACSTLSAGRAIPQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.67
4 0.73
5 0.76
6 0.77
7 0.81
8 0.81
9 0.76
10 0.68
11 0.63
12 0.56
13 0.48
14 0.4
15 0.31
16 0.25
17 0.21
18 0.22
19 0.19
20 0.17
21 0.17
22 0.14
23 0.15
24 0.14
25 0.15
26 0.12
27 0.12
28 0.11
29 0.14
30 0.15
31 0.14
32 0.13
33 0.14
34 0.14
35 0.14
36 0.14
37 0.13
38 0.12
39 0.12
40 0.11
41 0.09
42 0.1
43 0.11
44 0.13
45 0.14
46 0.16
47 0.18
48 0.23
49 0.22
50 0.2
51 0.18
52 0.18
53 0.15
54 0.12
55 0.1
56 0.06
57 0.08
58 0.09
59 0.09
60 0.09
61 0.11
62 0.15
63 0.19
64 0.22
65 0.23
66 0.23
67 0.27
68 0.35
69 0.36
70 0.35
71 0.31
72 0.31
73 0.28
74 0.28
75 0.26
76 0.18
77 0.16
78 0.16
79 0.17
80 0.16
81 0.22
82 0.26
83 0.26
84 0.27
85 0.27